Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177D6A0

Protein Details
Accession A0A177D6A0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
92-117GATLDKPKTTPKKRKNKTVEGEDDPAHydrophilic
NLS Segment(s)
PositionSequence
99-108KTTPKKRKNK
122-123KK
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 9, cyto 3.5
Family & Domain DBs
KEGG aalt:CC77DRAFT_904169  -  
Amino Acid Sequences MSDEEQKTPSKAASSGGAWSEQEKIAYLMVLCEHAADTEKFESKTNTCPVPAGRTTLSCRKLILRMKEKHGEDMEKIKNGLPLGSAAGDGVGATLDKPKTTPKKRKNKTVEGEDDPAEGSPKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.2
5 0.18
6 0.18
7 0.19
8 0.16
9 0.15
10 0.13
11 0.12
12 0.11
13 0.11
14 0.1
15 0.08
16 0.08
17 0.08
18 0.07
19 0.07
20 0.07
21 0.06
22 0.09
23 0.08
24 0.11
25 0.12
26 0.15
27 0.16
28 0.17
29 0.2
30 0.19
31 0.25
32 0.26
33 0.25
34 0.22
35 0.23
36 0.23
37 0.26
38 0.25
39 0.22
40 0.19
41 0.2
42 0.24
43 0.3
44 0.31
45 0.26
46 0.26
47 0.25
48 0.31
49 0.34
50 0.39
51 0.41
52 0.42
53 0.48
54 0.54
55 0.53
56 0.51
57 0.47
58 0.41
59 0.33
60 0.37
61 0.34
62 0.29
63 0.29
64 0.25
65 0.25
66 0.22
67 0.2
68 0.13
69 0.11
70 0.1
71 0.1
72 0.08
73 0.06
74 0.06
75 0.05
76 0.04
77 0.04
78 0.03
79 0.03
80 0.03
81 0.07
82 0.08
83 0.08
84 0.1
85 0.19
86 0.3
87 0.41
88 0.52
89 0.59
90 0.7
91 0.79
92 0.89
93 0.9
94 0.9
95 0.89
96 0.88
97 0.86
98 0.81
99 0.76
100 0.66
101 0.56
102 0.46
103 0.37
104 0.29
105 0.23