Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177DEU7

Protein Details
Accession A0A177DEU7    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
145-164QKEWDKEKKKEAKTEAKVEIBasic
NLS Segment(s)
PositionSequence
149-156DKEKKKEA
Subcellular Location(s) mito 18, nucl 6, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR025494  DUF4385  
KEGG aalt:CC77DRAFT_941639  -  
Pfam View protein in Pfam  
PF14328  DUF4385  
Amino Acid Sequences MPSEPLTKSQRMAYRIGRGETGVLTFEPYKSEILPLWRFKTPAIARKSSSDIYSKFLEYDKNDDFIGMDMSRKFLQMGMTRAKRYANHAGGRKYDKKTGELLEKSKGHEGQEEKLEASGIFREVWEKAKLHNGYVEKKERFMKEQKEWDKEKKKEAKTEAKVEIKTEVKEEAEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.52
4 0.45
5 0.39
6 0.38
7 0.32
8 0.26
9 0.18
10 0.13
11 0.14
12 0.13
13 0.13
14 0.13
15 0.14
16 0.14
17 0.13
18 0.15
19 0.14
20 0.21
21 0.27
22 0.31
23 0.34
24 0.35
25 0.35
26 0.34
27 0.42
28 0.4
29 0.42
30 0.43
31 0.43
32 0.43
33 0.46
34 0.5
35 0.42
36 0.38
37 0.35
38 0.3
39 0.29
40 0.29
41 0.26
42 0.22
43 0.21
44 0.23
45 0.2
46 0.25
47 0.22
48 0.22
49 0.21
50 0.2
51 0.19
52 0.15
53 0.16
54 0.1
55 0.1
56 0.09
57 0.11
58 0.11
59 0.11
60 0.11
61 0.09
62 0.14
63 0.16
64 0.2
65 0.26
66 0.29
67 0.29
68 0.3
69 0.31
70 0.27
71 0.3
72 0.34
73 0.32
74 0.34
75 0.39
76 0.4
77 0.43
78 0.48
79 0.48
80 0.43
81 0.42
82 0.38
83 0.35
84 0.36
85 0.36
86 0.37
87 0.35
88 0.35
89 0.36
90 0.36
91 0.35
92 0.36
93 0.34
94 0.26
95 0.28
96 0.28
97 0.24
98 0.27
99 0.26
100 0.22
101 0.21
102 0.2
103 0.15
104 0.14
105 0.11
106 0.08
107 0.07
108 0.07
109 0.09
110 0.09
111 0.13
112 0.16
113 0.15
114 0.16
115 0.25
116 0.26
117 0.26
118 0.31
119 0.32
120 0.35
121 0.43
122 0.5
123 0.42
124 0.46
125 0.52
126 0.49
127 0.51
128 0.53
129 0.55
130 0.55
131 0.65
132 0.69
133 0.71
134 0.74
135 0.78
136 0.8
137 0.76
138 0.78
139 0.77
140 0.76
141 0.77
142 0.79
143 0.8
144 0.77
145 0.8
146 0.79
147 0.76
148 0.7
149 0.62
150 0.59
151 0.53
152 0.46
153 0.39
154 0.34
155 0.27