Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177DRE8

Protein Details
Accession A0A177DRE8    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
112-132AMVIKPKKQLRWDRREGKLDDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8
Family & Domain DBs
KEGG aalt:CC77DRAFT_1060507  -  
Amino Acid Sequences MYFTIRLAANRSRNKACQNADSKPVLLNPESGRESRLSHRLSRQQTQQEHYQGLQQRYSSAPPSPSIELLPEIKTSSSDDKANEWLERGVADNGIDVVHGDLGQKKPEMTQAMVIKPKKQLRWDRREGKLDDGSGHSKVVERTDKDGMVCTEYRAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.67
3 0.63
4 0.63
5 0.62
6 0.6
7 0.6
8 0.56
9 0.5
10 0.43
11 0.4
12 0.34
13 0.28
14 0.28
15 0.23
16 0.27
17 0.28
18 0.27
19 0.26
20 0.25
21 0.27
22 0.27
23 0.34
24 0.31
25 0.34
26 0.42
27 0.49
28 0.53
29 0.56
30 0.59
31 0.6
32 0.62
33 0.6
34 0.6
35 0.54
36 0.5
37 0.44
38 0.41
39 0.39
40 0.36
41 0.34
42 0.26
43 0.24
44 0.24
45 0.25
46 0.22
47 0.18
48 0.17
49 0.17
50 0.2
51 0.19
52 0.18
53 0.16
54 0.15
55 0.14
56 0.15
57 0.14
58 0.11
59 0.11
60 0.1
61 0.1
62 0.12
63 0.13
64 0.14
65 0.14
66 0.15
67 0.16
68 0.19
69 0.19
70 0.17
71 0.15
72 0.13
73 0.12
74 0.11
75 0.11
76 0.09
77 0.07
78 0.07
79 0.06
80 0.06
81 0.06
82 0.06
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.08
89 0.09
90 0.11
91 0.12
92 0.12
93 0.12
94 0.17
95 0.19
96 0.17
97 0.22
98 0.25
99 0.29
100 0.37
101 0.37
102 0.36
103 0.41
104 0.46
105 0.45
106 0.51
107 0.57
108 0.61
109 0.69
110 0.77
111 0.78
112 0.8
113 0.83
114 0.76
115 0.72
116 0.66
117 0.57
118 0.49
119 0.45
120 0.4
121 0.32
122 0.3
123 0.23
124 0.21
125 0.21
126 0.26
127 0.29
128 0.29
129 0.33
130 0.38
131 0.39
132 0.37
133 0.4
134 0.34
135 0.31
136 0.29