Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2XBK1

Protein Details
Accession G2XBK1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAPAAGAKKQKKKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
6-19GAKKQKKKGKVKDK
Subcellular Location(s) nucl 12, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG vda:VDAG_07533  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAGAKKQKKKGKVKDKAQHAVILDKQTSEKLYKDVQSFRLVTVATLVDRMKINGSLARRCIKDLEEKGLIRPVVQHSKMQIYTRAVGGTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.89
4 0.88
5 0.9
6 0.88
7 0.79
8 0.72
9 0.61
10 0.56
11 0.48
12 0.43
13 0.33
14 0.26
15 0.24
16 0.22
17 0.22
18 0.19
19 0.16
20 0.15
21 0.19
22 0.22
23 0.25
24 0.28
25 0.28
26 0.31
27 0.3
28 0.27
29 0.25
30 0.21
31 0.17
32 0.14
33 0.12
34 0.08
35 0.09
36 0.08
37 0.08
38 0.08
39 0.09
40 0.09
41 0.09
42 0.1
43 0.11
44 0.15
45 0.16
46 0.21
47 0.25
48 0.25
49 0.26
50 0.27
51 0.26
52 0.32
53 0.32
54 0.35
55 0.36
56 0.35
57 0.36
58 0.39
59 0.37
60 0.27
61 0.28
62 0.29
63 0.32
64 0.34
65 0.35
66 0.33
67 0.4
68 0.44
69 0.43
70 0.42
71 0.37
72 0.38
73 0.37