Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177D5J4

Protein Details
Accession A0A177D5J4    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
103-126DATPSRKKVTPKSRGKKSQTPLETHydrophilic
NLS Segment(s)
PositionSequence
108-119RKKVTPKSRGKK
Subcellular Location(s) mito_nucl 10.333, nucl 10, cyto_mito 8.666, mito 8.5, cyto 7.5
Family & Domain DBs
KEGG aalt:CC77DRAFT_1000103  -  
Amino Acid Sequences MPPKAATLDGQKVVPADCVSVLLMALGSTTITKAQYEMMSALDGTRTASSFEHQFRTITAKAKELKARAEKGETFQAVTPVNKRQTTPATPNKRKAASSGSDDATPSRKKVTPKSRGKKSQTPLETMDDTFPEDAEEFIKNEAKWEEEVFSQRTMGIIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.19
3 0.13
4 0.11
5 0.12
6 0.11
7 0.1
8 0.09
9 0.07
10 0.06
11 0.05
12 0.05
13 0.04
14 0.04
15 0.04
16 0.04
17 0.06
18 0.06
19 0.07
20 0.07
21 0.1
22 0.1
23 0.11
24 0.11
25 0.1
26 0.1
27 0.1
28 0.1
29 0.07
30 0.07
31 0.07
32 0.07
33 0.07
34 0.08
35 0.08
36 0.1
37 0.15
38 0.18
39 0.2
40 0.2
41 0.2
42 0.19
43 0.24
44 0.25
45 0.26
46 0.25
47 0.27
48 0.29
49 0.34
50 0.37
51 0.33
52 0.38
53 0.38
54 0.4
55 0.36
56 0.37
57 0.34
58 0.32
59 0.34
60 0.27
61 0.22
62 0.19
63 0.2
64 0.17
65 0.17
66 0.17
67 0.18
68 0.22
69 0.21
70 0.22
71 0.23
72 0.28
73 0.32
74 0.38
75 0.42
76 0.49
77 0.55
78 0.62
79 0.63
80 0.61
81 0.56
82 0.5
83 0.46
84 0.39
85 0.38
86 0.35
87 0.3
88 0.28
89 0.28
90 0.26
91 0.26
92 0.24
93 0.19
94 0.2
95 0.23
96 0.28
97 0.38
98 0.47
99 0.52
100 0.62
101 0.72
102 0.78
103 0.85
104 0.87
105 0.87
106 0.83
107 0.83
108 0.75
109 0.7
110 0.63
111 0.58
112 0.52
113 0.43
114 0.37
115 0.28
116 0.26
117 0.21
118 0.17
119 0.13
120 0.11
121 0.1
122 0.1
123 0.11
124 0.1
125 0.12
126 0.17
127 0.15
128 0.19
129 0.19
130 0.2
131 0.21
132 0.22
133 0.22
134 0.21
135 0.26
136 0.25
137 0.25
138 0.23
139 0.21