Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177DVZ1

Protein Details
Accession A0A177DVZ1   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
208-234AVDNKKRKHTNTHVAKQPRKTLPKKSVHydrophilic
NLS Segment(s)
PositionSequence
213-215KRK
222-232AKQPRKTLPKK
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 7
Family & Domain DBs
KEGG aalt:CC77DRAFT_1084052  -  
Amino Acid Sequences MVPVKAVPEKTREEPRVDSGAALSDPAALSSGSANNKLTMPILRNTNWNYGAPKARYRKNELQLRQPKGFPIKPLKITLDRAREEAELEAATKRYADPDFEIYEDWKENDELEEEDDYDGKVEPESEAADSIAEDILDGFAYGSMDGNADESDASTDLPTFRVIPEKPAALVDSLGRTRAATSRRKAQEVSDAIISLGVSREGNGNAAVDNKKRKHTNTHVAKQPRKTLPKKSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.54
4 0.47
5 0.41
6 0.31
7 0.3
8 0.24
9 0.2
10 0.14
11 0.1
12 0.1
13 0.09
14 0.09
15 0.06
16 0.07
17 0.08
18 0.13
19 0.14
20 0.16
21 0.17
22 0.18
23 0.18
24 0.19
25 0.19
26 0.18
27 0.19
28 0.21
29 0.26
30 0.25
31 0.31
32 0.34
33 0.39
34 0.37
35 0.36
36 0.34
37 0.34
38 0.41
39 0.38
40 0.43
41 0.45
42 0.5
43 0.54
44 0.61
45 0.65
46 0.67
47 0.74
48 0.69
49 0.72
50 0.75
51 0.75
52 0.69
53 0.6
54 0.56
55 0.54
56 0.52
57 0.48
58 0.48
59 0.48
60 0.48
61 0.51
62 0.5
63 0.46
64 0.5
65 0.5
66 0.49
67 0.43
68 0.41
69 0.4
70 0.35
71 0.31
72 0.25
73 0.19
74 0.11
75 0.11
76 0.1
77 0.09
78 0.08
79 0.08
80 0.07
81 0.09
82 0.09
83 0.1
84 0.11
85 0.14
86 0.15
87 0.15
88 0.16
89 0.14
90 0.15
91 0.14
92 0.12
93 0.1
94 0.09
95 0.09
96 0.09
97 0.09
98 0.08
99 0.08
100 0.08
101 0.08
102 0.08
103 0.08
104 0.07
105 0.06
106 0.06
107 0.05
108 0.04
109 0.04
110 0.04
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.04
120 0.04
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.04
133 0.04
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.05
140 0.05
141 0.05
142 0.05
143 0.06
144 0.06
145 0.07
146 0.07
147 0.07
148 0.07
149 0.14
150 0.14
151 0.18
152 0.2
153 0.2
154 0.2
155 0.2
156 0.2
157 0.14
158 0.15
159 0.12
160 0.13
161 0.13
162 0.14
163 0.13
164 0.12
165 0.13
166 0.18
167 0.24
168 0.28
169 0.33
170 0.42
171 0.47
172 0.5
173 0.5
174 0.48
175 0.51
176 0.46
177 0.43
178 0.34
179 0.3
180 0.26
181 0.25
182 0.22
183 0.13
184 0.1
185 0.08
186 0.07
187 0.07
188 0.09
189 0.09
190 0.11
191 0.11
192 0.1
193 0.1
194 0.15
195 0.19
196 0.23
197 0.33
198 0.36
199 0.45
200 0.51
201 0.56
202 0.61
203 0.67
204 0.72
205 0.73
206 0.79
207 0.8
208 0.84
209 0.87
210 0.84
211 0.84
212 0.83
213 0.83
214 0.82