Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177DIP3

Protein Details
Accession A0A177DIP3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-86FPSRYWSKQIREHERKQDQNIIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, plas 6, mito_nucl 6, cyto 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG aalt:CC77DRAFT_1062444  -  
Amino Acid Sequences MGGGGKIPYPKHVWSPAGGWYAQPANWKANTAVVGLALGSIVGMAWMLSANREYRDKMPERHRFFPSRYWSKQIREHERKQDQNIIERTIEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.36
4 0.34
5 0.31
6 0.25
7 0.22
8 0.21
9 0.2
10 0.23
11 0.2
12 0.21
13 0.21
14 0.23
15 0.2
16 0.21
17 0.2
18 0.16
19 0.14
20 0.1
21 0.09
22 0.08
23 0.07
24 0.04
25 0.03
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.01
32 0.02
33 0.02
34 0.02
35 0.03
36 0.04
37 0.05
38 0.07
39 0.09
40 0.11
41 0.14
42 0.22
43 0.26
44 0.33
45 0.43
46 0.51
47 0.57
48 0.61
49 0.64
50 0.61
51 0.6
52 0.61
53 0.61
54 0.6
55 0.57
56 0.58
57 0.59
58 0.6
59 0.66
60 0.68
61 0.69
62 0.69
63 0.74
64 0.78
65 0.82
66 0.83
67 0.8
68 0.79
69 0.72
70 0.71
71 0.67
72 0.6