Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177DCL9

Protein Details
Accession A0A177DCL9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
53-80MSVTRSSLRYKRWREKRRTQNMYTEVRLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cysk 8, cyto_nucl 6.5, mito 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG aalt:CC77DRAFT_1023935  -  
Amino Acid Sequences MCCGMTLGRLTLADIVRYVAFINHDVISLAGLVVDSLFDRAIGYTGSIVAVTMSVTRSSLRYKRWREKRRTQNMYTEVRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.12
4 0.13
5 0.12
6 0.08
7 0.09
8 0.1
9 0.12
10 0.1
11 0.1
12 0.1
13 0.1
14 0.09
15 0.07
16 0.06
17 0.04
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.03
37 0.03
38 0.03
39 0.04
40 0.05
41 0.05
42 0.06
43 0.06
44 0.09
45 0.16
46 0.21
47 0.29
48 0.39
49 0.49
50 0.59
51 0.7
52 0.79
53 0.83
54 0.89
55 0.91
56 0.92
57 0.91
58 0.86
59 0.85
60 0.83