Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2X3X9

Protein Details
Accession G2X3X9    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
72-93RASGRPDKRVRPTPKKVVRITSHydrophilic
NLS Segment(s)
PositionSequence
55-87KVSGGSKGGSAKRSAPARASGRPDKRVRPTPKK
Subcellular Location(s) mito 15, nucl 10, cyto_nucl 7
Family & Domain DBs
KEGG vda:VDAG_04716  -  
Amino Acid Sequences MLYKNEKQNSNAGPTTASSVRRLIGAKVPCGNHHRGQLLPTPVPKGSALKSSASKVSGGSKGGSAKRSAPARASGRPDKRVRPTPKKVVRITSDGREEDELTFNGSEAGEDLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.3
4 0.27
5 0.22
6 0.23
7 0.22
8 0.24
9 0.24
10 0.21
11 0.24
12 0.25
13 0.27
14 0.3
15 0.31
16 0.33
17 0.37
18 0.4
19 0.37
20 0.38
21 0.36
22 0.32
23 0.34
24 0.35
25 0.34
26 0.31
27 0.29
28 0.27
29 0.25
30 0.26
31 0.24
32 0.2
33 0.17
34 0.19
35 0.19
36 0.19
37 0.21
38 0.21
39 0.21
40 0.2
41 0.18
42 0.15
43 0.16
44 0.15
45 0.15
46 0.13
47 0.13
48 0.17
49 0.19
50 0.19
51 0.17
52 0.18
53 0.22
54 0.25
55 0.25
56 0.23
57 0.28
58 0.31
59 0.35
60 0.4
61 0.44
62 0.48
63 0.55
64 0.58
65 0.59
66 0.63
67 0.68
68 0.71
69 0.73
70 0.76
71 0.78
72 0.83
73 0.84
74 0.8
75 0.78
76 0.73
77 0.7
78 0.66
79 0.62
80 0.58
81 0.5
82 0.47
83 0.41
84 0.38
85 0.32
86 0.3
87 0.24
88 0.2
89 0.19
90 0.16
91 0.15
92 0.13
93 0.12