Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177DKX4

Protein Details
Accession A0A177DKX4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
26-46AAHLLRQRRLRAKKQPRLDVEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, mito 9, pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG aalt:CC77DRAFT_1072016  -  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MTWSKNNTISVLALFASCTPIFILLAAHLLRQRRLRAKKQPRLDVEGTPTAPQPQSSQYVWIRREYTLVALILIQRDAHFADRGTWAMRSRYGGSDSSSTPLTPWKDTHYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.12
4 0.1
5 0.1
6 0.09
7 0.1
8 0.1
9 0.1
10 0.1
11 0.06
12 0.1
13 0.09
14 0.1
15 0.12
16 0.14
17 0.18
18 0.22
19 0.29
20 0.36
21 0.44
22 0.53
23 0.62
24 0.71
25 0.76
26 0.81
27 0.83
28 0.78
29 0.77
30 0.69
31 0.61
32 0.54
33 0.48
34 0.4
35 0.31
36 0.27
37 0.21
38 0.19
39 0.17
40 0.13
41 0.12
42 0.15
43 0.14
44 0.2
45 0.22
46 0.28
47 0.29
48 0.31
49 0.3
50 0.27
51 0.28
52 0.23
53 0.21
54 0.16
55 0.15
56 0.11
57 0.1
58 0.11
59 0.1
60 0.09
61 0.08
62 0.06
63 0.07
64 0.08
65 0.09
66 0.1
67 0.1
68 0.12
69 0.13
70 0.14
71 0.15
72 0.16
73 0.17
74 0.19
75 0.2
76 0.22
77 0.23
78 0.25
79 0.26
80 0.25
81 0.26
82 0.27
83 0.26
84 0.25
85 0.23
86 0.2
87 0.18
88 0.23
89 0.24
90 0.24
91 0.25