Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177DEE8

Protein Details
Accession A0A177DEE8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
63-89SVMSRALRKSRPHRWRKDKVQFSLKLSHydrophilic
NLS Segment(s)
PositionSequence
70-78RKSRPHRWR
Subcellular Location(s) mito 12, nucl 10, cyto 4
Family & Domain DBs
KEGG aalt:CC77DRAFT_239187  -  
Amino Acid Sequences MACTSNVVSNGQTPLALLYRTVATSERFELSSYLQPEPYEGGEIAKDQPGAEPLYTLCVVVISVMSRALRKSRPHRWRKDKVQFSLKLSVCSAASSKPSPPYNQELRSNVTGPRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.1
5 0.1
6 0.11
7 0.11
8 0.12
9 0.12
10 0.12
11 0.15
12 0.17
13 0.17
14 0.16
15 0.17
16 0.17
17 0.18
18 0.22
19 0.22
20 0.21
21 0.2
22 0.2
23 0.2
24 0.2
25 0.17
26 0.13
27 0.1
28 0.09
29 0.09
30 0.1
31 0.1
32 0.1
33 0.09
34 0.08
35 0.08
36 0.09
37 0.1
38 0.09
39 0.08
40 0.07
41 0.09
42 0.09
43 0.09
44 0.07
45 0.06
46 0.06
47 0.05
48 0.06
49 0.03
50 0.03
51 0.05
52 0.05
53 0.06
54 0.07
55 0.11
56 0.17
57 0.25
58 0.33
59 0.43
60 0.54
61 0.64
62 0.74
63 0.81
64 0.86
65 0.89
66 0.91
67 0.9
68 0.87
69 0.87
70 0.81
71 0.75
72 0.74
73 0.64
74 0.55
75 0.47
76 0.4
77 0.3
78 0.27
79 0.22
80 0.15
81 0.19
82 0.18
83 0.21
84 0.27
85 0.3
86 0.33
87 0.37
88 0.43
89 0.48
90 0.52
91 0.57
92 0.53
93 0.56
94 0.56
95 0.53