Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2XDV4

Protein Details
Accession G2XDV4    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
4-34EAPAEPVKRGRGRPRKPDSEKKQKQRVDDGTBasic
NLS Segment(s)
PositionSequence
10-50VKRGRGRPRKPDSEKKQKQRVDDGTPRRGRGRPKGSLGKPK
101-111KGGRGRGRPRK
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG vda:VDAG_08336  -  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MASEAPAEPVKRGRGRPRKPDSEKKQKQRVDDGTPRRGRGRPKGSLGKPKVLTAAAGVSKSTSAMNTRSTGTRGRPRKSDAAGAPAASTTKAAGTTQTPSKGGRGRGRPRKSDAAASSPAVEREEPESAASEADVPAADESPRSKSAASPEAEQDEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.68
3 0.77
4 0.82
5 0.84
6 0.87
7 0.9
8 0.9
9 0.9
10 0.91
11 0.91
12 0.91
13 0.85
14 0.82
15 0.81
16 0.77
17 0.76
18 0.75
19 0.73
20 0.73
21 0.73
22 0.7
23 0.64
24 0.61
25 0.6
26 0.6
27 0.6
28 0.57
29 0.6
30 0.67
31 0.69
32 0.76
33 0.72
34 0.69
35 0.62
36 0.56
37 0.49
38 0.39
39 0.32
40 0.22
41 0.22
42 0.14
43 0.13
44 0.12
45 0.1
46 0.1
47 0.1
48 0.09
49 0.07
50 0.08
51 0.09
52 0.12
53 0.13
54 0.14
55 0.15
56 0.17
57 0.19
58 0.23
59 0.3
60 0.36
61 0.38
62 0.4
63 0.44
64 0.47
65 0.46
66 0.46
67 0.38
68 0.35
69 0.32
70 0.28
71 0.24
72 0.19
73 0.17
74 0.11
75 0.1
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.08
82 0.11
83 0.14
84 0.16
85 0.17
86 0.17
87 0.21
88 0.25
89 0.3
90 0.35
91 0.42
92 0.51
93 0.6
94 0.66
95 0.68
96 0.7
97 0.71
98 0.66
99 0.64
100 0.57
101 0.52
102 0.48
103 0.43
104 0.38
105 0.31
106 0.29
107 0.23
108 0.19
109 0.15
110 0.16
111 0.17
112 0.15
113 0.15
114 0.16
115 0.15
116 0.15
117 0.14
118 0.11
119 0.09
120 0.09
121 0.08
122 0.07
123 0.07
124 0.08
125 0.08
126 0.09
127 0.11
128 0.15
129 0.17
130 0.18
131 0.18
132 0.2
133 0.27
134 0.33
135 0.34
136 0.33
137 0.36