Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177D5Q7

Protein Details
Accession A0A177D5Q7   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
36-57PHPDDLPRKKEKKRQLSLSEDEBasic
NLS Segment(s)
PositionSequence
44-48KKEKK
Subcellular Location(s) nucl 12, mito 10, cyto 2, pero 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG aalt:CC77DRAFT_949184  -  
Amino Acid Sequences MRHPAAPTVIAVLLGFLFFMVLWSRARDDGHHEGNPHPDDLPRKKEKKRQLSLSEDESDTAEPRQQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.03
4 0.03
5 0.03
6 0.04
7 0.05
8 0.06
9 0.07
10 0.08
11 0.1
12 0.11
13 0.12
14 0.12
15 0.18
16 0.23
17 0.26
18 0.27
19 0.27
20 0.26
21 0.31
22 0.31
23 0.25
24 0.19
25 0.17
26 0.24
27 0.28
28 0.36
29 0.4
30 0.48
31 0.55
32 0.64
33 0.72
34 0.76
35 0.8
36 0.81
37 0.8
38 0.8
39 0.78
40 0.74
41 0.67
42 0.57
43 0.48
44 0.39
45 0.32
46 0.25
47 0.21