Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XIQ7

Protein Details
Accession G2XIQ7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
95-121SAPNLLQRKHTRMRRKGSSARDNLRRRHydrophilic
NLS Segment(s)
PositionSequence
92-121PPPSAPNLLQRKHTRMRRKGSSARDNLRRR
Subcellular Location(s) mito 12, extr 8, nucl 3, plas 3
Family & Domain DBs
KEGG vda:VDAG_10105  -  
Amino Acid Sequences MPCRNRNMPTRPPLRSQGNILATAPAVLLAVPPTLTRTGRRYLTLLSVDGYRIASRNATIARSSRGAWKILKGVLGRTATQAPRRQHNLKAPPPSAPNLLQRKHTRMRRKGSSARDNLRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.63
3 0.59
4 0.58
5 0.52
6 0.48
7 0.43
8 0.35
9 0.28
10 0.25
11 0.19
12 0.1
13 0.07
14 0.05
15 0.05
16 0.04
17 0.05
18 0.05
19 0.05
20 0.07
21 0.1
22 0.11
23 0.15
24 0.18
25 0.23
26 0.25
27 0.27
28 0.26
29 0.25
30 0.28
31 0.26
32 0.23
33 0.18
34 0.16
35 0.15
36 0.13
37 0.13
38 0.09
39 0.08
40 0.08
41 0.07
42 0.07
43 0.09
44 0.1
45 0.1
46 0.11
47 0.12
48 0.13
49 0.14
50 0.15
51 0.18
52 0.19
53 0.21
54 0.2
55 0.21
56 0.22
57 0.21
58 0.24
59 0.19
60 0.18
61 0.21
62 0.21
63 0.2
64 0.19
65 0.23
66 0.22
67 0.28
68 0.34
69 0.33
70 0.39
71 0.46
72 0.48
73 0.51
74 0.58
75 0.62
76 0.62
77 0.68
78 0.61
79 0.58
80 0.58
81 0.54
82 0.48
83 0.42
84 0.44
85 0.44
86 0.45
87 0.49
88 0.53
89 0.57
90 0.63
91 0.69
92 0.7
93 0.71
94 0.79
95 0.8
96 0.83
97 0.84
98 0.85
99 0.86
100 0.85
101 0.86