Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177D5Q5

Protein Details
Accession A0A177D5Q5    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAPIKKRTTARAKSARAARPSHydrophilic
30-76GISSLPSSKRDKQKIKHSSFVSKIEKSSAKTQKRRRPNNKLVANLESHydrophilic
102-130VKLESMKRTKGAKKRKEKLDKLEKERFNABasic
NLS Segment(s)
PositionSequence
5-66KKRTTARAKSARAARPSTAALPKPDGISSLPSSKRDKQKIKHSSFVSKIEKSSAKTQKRRRP
106-122SMKRTKGAKKRKEKLDK
Subcellular Location(s) mito 12, cyto_nucl 8, nucl 7, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013154  ADH-like_N  
IPR011032  GroES-like_sf  
IPR036291  NAD(P)-bd_dom_sf  
IPR028160  Slx9-like  
IPR047122  Trans-enoyl_RdTase-like  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0016651  F:oxidoreductase activity, acting on NAD(P)H  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG aalt:CC77DRAFT_1013583  -  
Pfam View protein in Pfam  
PF08240  ADH_N  
PF15341  SLX9  
CDD cd08249  enoyl_reductase_like  
Amino Acid Sequences MAPIKKRTTARAKSARAARPSTAALPKPDGISSLPSSKRDKQKIKHSSFVSKIEKSSAKTQKRRRPNNKLVANLESLADALPDAATAGELETSQARILQPKVKLESMKRTKGAKKRKEKLDKLEKERFNANLAQLIAGQHSRAMCRVTWKPSPSSRNNQVRPYNISPPGQCWNTVNIVLSAQITWFPMNILGAKGLQTALCCVMHRGNLPKDYYRLIIDDYTHRLFSARLPNICLFLPLDFVPIMNLAAVLPSPKASLSVQSLPIPAPASKELLIKVSTIGLNAIEAKIAKLAAIPVAYPAILGSSYTGTVEALGSAITNYCIGARVLVSKRFGTTGNQYSAYQSYVLAAAEEKMVIRIPEGSDEAVLASLVMNASCVPGLFSGQLGLRRPAEEIPAVGTEEKKKILIYGGSSSFGQLSVRYLCRAGYAVTTTASPRHVNRVCELGVDDAVDHTLPSQQIIQELKARGPYEVVVDMISTPQTILITSQVLKAQGGGILYATQPSFAPEDLPDGVQRVFKAWSEPLYEQENERLLEWVIEEYLPFGIQKGWIVAQPVDRVQAGLAGIDGALENLLSNAEGSGKRFVVNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.77
4 0.73
5 0.64
6 0.58
7 0.56
8 0.54
9 0.52
10 0.48
11 0.45
12 0.45
13 0.45
14 0.42
15 0.39
16 0.34
17 0.27
18 0.28
19 0.28
20 0.32
21 0.34
22 0.37
23 0.44
24 0.51
25 0.6
26 0.65
27 0.71
28 0.72
29 0.79
30 0.85
31 0.85
32 0.85
33 0.81
34 0.8
35 0.76
36 0.76
37 0.73
38 0.65
39 0.59
40 0.58
41 0.57
42 0.51
43 0.55
44 0.56
45 0.59
46 0.66
47 0.75
48 0.77
49 0.84
50 0.91
51 0.92
52 0.92
53 0.93
54 0.93
55 0.91
56 0.89
57 0.83
58 0.76
59 0.68
60 0.57
61 0.46
62 0.35
63 0.27
64 0.19
65 0.13
66 0.08
67 0.06
68 0.05
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.06
78 0.06
79 0.07
80 0.07
81 0.1
82 0.1
83 0.15
84 0.19
85 0.24
86 0.28
87 0.33
88 0.38
89 0.4
90 0.45
91 0.46
92 0.54
93 0.57
94 0.6
95 0.59
96 0.63
97 0.68
98 0.72
99 0.77
100 0.76
101 0.78
102 0.8
103 0.86
104 0.89
105 0.9
106 0.9
107 0.91
108 0.9
109 0.88
110 0.88
111 0.81
112 0.73
113 0.69
114 0.59
115 0.51
116 0.45
117 0.36
118 0.3
119 0.27
120 0.24
121 0.2
122 0.19
123 0.17
124 0.14
125 0.13
126 0.1
127 0.11
128 0.11
129 0.13
130 0.14
131 0.13
132 0.2
133 0.26
134 0.3
135 0.37
136 0.39
137 0.44
138 0.51
139 0.59
140 0.6
141 0.64
142 0.67
143 0.71
144 0.73
145 0.76
146 0.73
147 0.69
148 0.69
149 0.65
150 0.62
151 0.56
152 0.54
153 0.46
154 0.44
155 0.45
156 0.38
157 0.34
158 0.28
159 0.26
160 0.25
161 0.25
162 0.22
163 0.16
164 0.15
165 0.15
166 0.13
167 0.1
168 0.08
169 0.07
170 0.07
171 0.07
172 0.07
173 0.06
174 0.06
175 0.07
176 0.08
177 0.07
178 0.07
179 0.07
180 0.08
181 0.08
182 0.08
183 0.08
184 0.07
185 0.08
186 0.09
187 0.1
188 0.09
189 0.11
190 0.12
191 0.14
192 0.17
193 0.23
194 0.25
195 0.29
196 0.31
197 0.31
198 0.32
199 0.31
200 0.3
201 0.24
202 0.21
203 0.18
204 0.17
205 0.16
206 0.17
207 0.2
208 0.2
209 0.19
210 0.18
211 0.17
212 0.16
213 0.2
214 0.26
215 0.26
216 0.25
217 0.29
218 0.3
219 0.31
220 0.3
221 0.26
222 0.16
223 0.12
224 0.13
225 0.09
226 0.1
227 0.08
228 0.08
229 0.07
230 0.07
231 0.07
232 0.05
233 0.05
234 0.03
235 0.04
236 0.04
237 0.04
238 0.04
239 0.04
240 0.04
241 0.04
242 0.06
243 0.06
244 0.09
245 0.12
246 0.15
247 0.16
248 0.17
249 0.18
250 0.16
251 0.17
252 0.16
253 0.12
254 0.12
255 0.11
256 0.12
257 0.13
258 0.14
259 0.13
260 0.14
261 0.14
262 0.12
263 0.11
264 0.11
265 0.1
266 0.08
267 0.08
268 0.06
269 0.06
270 0.06
271 0.06
272 0.05
273 0.05
274 0.05
275 0.05
276 0.05
277 0.04
278 0.04
279 0.04
280 0.05
281 0.05
282 0.05
283 0.05
284 0.05
285 0.05
286 0.04
287 0.04
288 0.04
289 0.03
290 0.03
291 0.04
292 0.04
293 0.04
294 0.04
295 0.05
296 0.04
297 0.04
298 0.04
299 0.04
300 0.03
301 0.03
302 0.03
303 0.03
304 0.03
305 0.03
306 0.03
307 0.03
308 0.03
309 0.04
310 0.04
311 0.05
312 0.05
313 0.11
314 0.13
315 0.16
316 0.18
317 0.18
318 0.18
319 0.19
320 0.2
321 0.17
322 0.21
323 0.23
324 0.24
325 0.25
326 0.25
327 0.25
328 0.25
329 0.23
330 0.17
331 0.11
332 0.09
333 0.08
334 0.08
335 0.06
336 0.06
337 0.05
338 0.05
339 0.05
340 0.05
341 0.05
342 0.05
343 0.05
344 0.05
345 0.06
346 0.07
347 0.08
348 0.09
349 0.09
350 0.08
351 0.08
352 0.08
353 0.07
354 0.06
355 0.04
356 0.03
357 0.03
358 0.03
359 0.03
360 0.03
361 0.03
362 0.04
363 0.04
364 0.04
365 0.04
366 0.04
367 0.05
368 0.05
369 0.05
370 0.07
371 0.08
372 0.12
373 0.13
374 0.15
375 0.15
376 0.16
377 0.17
378 0.16
379 0.17
380 0.15
381 0.13
382 0.13
383 0.13
384 0.13
385 0.12
386 0.13
387 0.14
388 0.16
389 0.17
390 0.15
391 0.14
392 0.14
393 0.17
394 0.17
395 0.17
396 0.19
397 0.2
398 0.21
399 0.21
400 0.2
401 0.17
402 0.15
403 0.13
404 0.08
405 0.09
406 0.12
407 0.14
408 0.14
409 0.15
410 0.14
411 0.15
412 0.16
413 0.14
414 0.12
415 0.12
416 0.12
417 0.12
418 0.13
419 0.13
420 0.14
421 0.16
422 0.17
423 0.17
424 0.26
425 0.3
426 0.31
427 0.32
428 0.35
429 0.32
430 0.3
431 0.3
432 0.22
433 0.17
434 0.15
435 0.13
436 0.09
437 0.09
438 0.08
439 0.06
440 0.05
441 0.08
442 0.08
443 0.09
444 0.1
445 0.1
446 0.15
447 0.17
448 0.19
449 0.22
450 0.24
451 0.24
452 0.28
453 0.28
454 0.23
455 0.23
456 0.21
457 0.18
458 0.17
459 0.16
460 0.11
461 0.11
462 0.11
463 0.1
464 0.1
465 0.07
466 0.06
467 0.06
468 0.06
469 0.06
470 0.07
471 0.08
472 0.1
473 0.11
474 0.13
475 0.15
476 0.15
477 0.15
478 0.15
479 0.14
480 0.12
481 0.12
482 0.09
483 0.08
484 0.08
485 0.08
486 0.1
487 0.09
488 0.08
489 0.08
490 0.1
491 0.11
492 0.11
493 0.12
494 0.11
495 0.15
496 0.16
497 0.17
498 0.16
499 0.16
500 0.17
501 0.18
502 0.17
503 0.16
504 0.16
505 0.16
506 0.2
507 0.2
508 0.23
509 0.27
510 0.28
511 0.29
512 0.33
513 0.33
514 0.31
515 0.33
516 0.33
517 0.27
518 0.27
519 0.24
520 0.2
521 0.19
522 0.18
523 0.14
524 0.11
525 0.11
526 0.1
527 0.09
528 0.09
529 0.09
530 0.08
531 0.08
532 0.08
533 0.09
534 0.11
535 0.12
536 0.13
537 0.14
538 0.18
539 0.2
540 0.23
541 0.25
542 0.26
543 0.26
544 0.24
545 0.23
546 0.2
547 0.2
548 0.15
549 0.12
550 0.1
551 0.08
552 0.07
553 0.07
554 0.07
555 0.04
556 0.04
557 0.04
558 0.04
559 0.04
560 0.04
561 0.04
562 0.05
563 0.05
564 0.09
565 0.11
566 0.14
567 0.19
568 0.19