Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2X8Q1

Protein Details
Accession G2X8Q1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
87-110LSCGPDSGRRRRRRDDGRGSRDPTBasic
NLS Segment(s)
PositionSequence
95-101RRRRRRD
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
KEGG vda:VDAG_06192  -  
Amino Acid Sequences MVTDRGGSHESSVAGPRDRLMMASQHSLDRLDARPMGSSSVVDADMSTLMREPRTVASIIVRPDPSMRLEPGKPQKMRKPETFPSSLSCGPDSGRRRRRRDDGRGSRDPTPLGARLHTQNTQQPYQRQPKRRRAAYSGAADRTSLIEDDLASIGSWSHDEPVSGEGKPTPAWSGCPPEAPSPSRTPWIPRLATPELSPLATDFEFCHCHGNDVCEDRINDVWYLSSRARVDAQGKILHPPLSRVVVEPSPKRRLTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.23
4 0.23
5 0.22
6 0.22
7 0.19
8 0.2
9 0.21
10 0.26
11 0.27
12 0.25
13 0.26
14 0.26
15 0.25
16 0.24
17 0.22
18 0.21
19 0.22
20 0.21
21 0.23
22 0.23
23 0.24
24 0.2
25 0.18
26 0.15
27 0.15
28 0.14
29 0.11
30 0.1
31 0.09
32 0.09
33 0.09
34 0.08
35 0.08
36 0.09
37 0.1
38 0.1
39 0.11
40 0.12
41 0.15
42 0.15
43 0.14
44 0.17
45 0.2
46 0.22
47 0.24
48 0.23
49 0.21
50 0.22
51 0.23
52 0.22
53 0.21
54 0.22
55 0.22
56 0.23
57 0.32
58 0.41
59 0.48
60 0.49
61 0.54
62 0.59
63 0.64
64 0.7
65 0.68
66 0.67
67 0.65
68 0.67
69 0.63
70 0.57
71 0.5
72 0.48
73 0.42
74 0.35
75 0.28
76 0.22
77 0.2
78 0.27
79 0.3
80 0.35
81 0.44
82 0.52
83 0.58
84 0.65
85 0.75
86 0.77
87 0.81
88 0.82
89 0.83
90 0.82
91 0.83
92 0.79
93 0.72
94 0.63
95 0.53
96 0.43
97 0.35
98 0.3
99 0.23
100 0.2
101 0.18
102 0.2
103 0.23
104 0.23
105 0.22
106 0.22
107 0.26
108 0.28
109 0.29
110 0.3
111 0.35
112 0.44
113 0.49
114 0.55
115 0.61
116 0.68
117 0.74
118 0.76
119 0.73
120 0.69
121 0.68
122 0.65
123 0.62
124 0.55
125 0.48
126 0.42
127 0.37
128 0.31
129 0.25
130 0.18
131 0.12
132 0.07
133 0.06
134 0.05
135 0.06
136 0.06
137 0.05
138 0.05
139 0.05
140 0.04
141 0.04
142 0.05
143 0.04
144 0.06
145 0.06
146 0.06
147 0.07
148 0.09
149 0.11
150 0.1
151 0.11
152 0.1
153 0.11
154 0.11
155 0.11
156 0.11
157 0.1
158 0.13
159 0.15
160 0.22
161 0.21
162 0.24
163 0.26
164 0.27
165 0.31
166 0.31
167 0.33
168 0.31
169 0.32
170 0.33
171 0.32
172 0.33
173 0.36
174 0.42
175 0.39
176 0.36
177 0.41
178 0.42
179 0.42
180 0.37
181 0.34
182 0.27
183 0.25
184 0.24
185 0.16
186 0.16
187 0.14
188 0.14
189 0.11
190 0.14
191 0.16
192 0.17
193 0.22
194 0.19
195 0.23
196 0.23
197 0.26
198 0.27
199 0.28
200 0.29
201 0.27
202 0.28
203 0.26
204 0.28
205 0.25
206 0.21
207 0.17
208 0.18
209 0.16
210 0.2
211 0.18
212 0.22
213 0.2
214 0.23
215 0.25
216 0.28
217 0.3
218 0.3
219 0.35
220 0.34
221 0.34
222 0.36
223 0.38
224 0.37
225 0.34
226 0.33
227 0.33
228 0.32
229 0.32
230 0.29
231 0.31
232 0.33
233 0.4
234 0.45
235 0.49
236 0.53