Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177DDT0

Protein Details
Accession A0A177DDT0    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
39-61DADHTTKRSGKRRKLSRDKEADQBasic
NLS Segment(s)
PositionSequence
46-53RSGKRRKL
Subcellular Location(s) nucl 17, cyto_nucl 11.833, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010730  HET  
KEGG aalt:CC77DRAFT_286509  -  
Pfam View protein in Pfam  
PF06985  HET  
Amino Acid Sequences MMSDIYRRASYVYVWLGKSDDYIELAMKTIKADFRQYYDADHTTKRSGKRRKLSRDKEADQDNESISTSGDEGSTNELFGSALQRFFENSYWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.25
4 0.24
5 0.24
6 0.19
7 0.13
8 0.1
9 0.11
10 0.1
11 0.1
12 0.1
13 0.1
14 0.09
15 0.09
16 0.09
17 0.11
18 0.12
19 0.17
20 0.18
21 0.21
22 0.24
23 0.24
24 0.25
25 0.26
26 0.27
27 0.24
28 0.24
29 0.22
30 0.23
31 0.27
32 0.3
33 0.36
34 0.43
35 0.5
36 0.59
37 0.67
38 0.74
39 0.81
40 0.84
41 0.84
42 0.84
43 0.78
44 0.75
45 0.71
46 0.62
47 0.53
48 0.46
49 0.37
50 0.28
51 0.25
52 0.18
53 0.13
54 0.1
55 0.08
56 0.07
57 0.07
58 0.06
59 0.07
60 0.11
61 0.11
62 0.1
63 0.1
64 0.1
65 0.1
66 0.1
67 0.13
68 0.1
69 0.12
70 0.13
71 0.13
72 0.15
73 0.17