Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177D268

Protein Details
Accession A0A177D268    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
68-90FDKPCHPTCIYPKCKNRPGHDENHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, E.R. 7, golg 3, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
KEGG aalt:CC77DRAFT_1068033  -  
Amino Acid Sequences MKLTVLVLAAVATVAFAGGGSKKNDDALCAACRDVYMPCKHKCDTSDRTVLCETYCELEVCDLKPKGFDKPCHPTCIYPKCKNRPGHDEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.03
5 0.05
6 0.09
7 0.1
8 0.12
9 0.13
10 0.16
11 0.16
12 0.17
13 0.18
14 0.18
15 0.18
16 0.17
17 0.17
18 0.14
19 0.13
20 0.13
21 0.13
22 0.15
23 0.2
24 0.26
25 0.29
26 0.34
27 0.35
28 0.36
29 0.36
30 0.39
31 0.38
32 0.37
33 0.41
34 0.37
35 0.4
36 0.38
37 0.36
38 0.27
39 0.22
40 0.17
41 0.12
42 0.13
43 0.1
44 0.09
45 0.11
46 0.12
47 0.12
48 0.19
49 0.18
50 0.17
51 0.2
52 0.22
53 0.29
54 0.35
55 0.39
56 0.4
57 0.5
58 0.53
59 0.57
60 0.57
61 0.55
62 0.58
63 0.63
64 0.65
65 0.64
66 0.71
67 0.75
68 0.81
69 0.84
70 0.82