Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177DR97

Protein Details
Accession A0A177DR97   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
240-263GENVHVPKEKPKKKTQLEAEKAELHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 12.333, nucl 11, mito_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR039470  Nuc_deoxyri_tr2  
KEGG aalt:CC77DRAFT_1020070  -  
Pfam View protein in Pfam  
PF15891  Nuc_deoxyri_tr2  
Amino Acid Sequences MRSHTTWSKIVEKFVGKDEKTGSEPTKANMPEEATKELAADMVKSPGMTSIDKVVEDKKNQLPPWPSPVPTPHKDFVHSNPPEPPKYRKFTVFTAGSIEMGDAVNWQPLMATMLNHLPITVCNPRKGSWDQSIKQQAKDELFKQQVVWELGALEQADVICFFFDTETKSPVSLLELGVWAASDKVIVCCGDAYWKSGNVHLTCERYDVPCVKNFTELVPLVEEMLKKKGMELDNKGDLIGENVHVPKEKPKKKTQLEAEKAELQKQVDDLLAKLAAQPKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.43
4 0.45
5 0.45
6 0.42
7 0.41
8 0.45
9 0.39
10 0.37
11 0.38
12 0.35
13 0.4
14 0.37
15 0.35
16 0.32
17 0.33
18 0.32
19 0.34
20 0.36
21 0.29
22 0.28
23 0.26
24 0.23
25 0.2
26 0.15
27 0.13
28 0.1
29 0.11
30 0.11
31 0.11
32 0.11
33 0.12
34 0.15
35 0.14
36 0.14
37 0.18
38 0.19
39 0.2
40 0.21
41 0.24
42 0.28
43 0.3
44 0.35
45 0.36
46 0.43
47 0.43
48 0.49
49 0.48
50 0.45
51 0.51
52 0.49
53 0.43
54 0.39
55 0.47
56 0.47
57 0.47
58 0.49
59 0.46
60 0.44
61 0.46
62 0.46
63 0.43
64 0.45
65 0.42
66 0.38
67 0.4
68 0.44
69 0.46
70 0.46
71 0.49
72 0.46
73 0.51
74 0.52
75 0.51
76 0.5
77 0.48
78 0.52
79 0.46
80 0.38
81 0.36
82 0.33
83 0.27
84 0.22
85 0.19
86 0.11
87 0.09
88 0.09
89 0.05
90 0.05
91 0.06
92 0.05
93 0.05
94 0.05
95 0.05
96 0.07
97 0.07
98 0.06
99 0.07
100 0.09
101 0.1
102 0.09
103 0.09
104 0.07
105 0.07
106 0.12
107 0.18
108 0.19
109 0.21
110 0.23
111 0.24
112 0.29
113 0.32
114 0.32
115 0.33
116 0.4
117 0.38
118 0.45
119 0.54
120 0.51
121 0.49
122 0.46
123 0.4
124 0.35
125 0.37
126 0.3
127 0.27
128 0.27
129 0.25
130 0.23
131 0.21
132 0.23
133 0.2
134 0.19
135 0.12
136 0.11
137 0.1
138 0.11
139 0.1
140 0.05
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.03
147 0.03
148 0.03
149 0.03
150 0.04
151 0.09
152 0.1
153 0.12
154 0.12
155 0.12
156 0.13
157 0.13
158 0.14
159 0.11
160 0.09
161 0.08
162 0.08
163 0.08
164 0.08
165 0.07
166 0.05
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.06
173 0.06
174 0.06
175 0.06
176 0.06
177 0.11
178 0.11
179 0.14
180 0.15
181 0.18
182 0.18
183 0.21
184 0.27
185 0.22
186 0.27
187 0.27
188 0.28
189 0.25
190 0.27
191 0.26
192 0.22
193 0.26
194 0.27
195 0.26
196 0.28
197 0.32
198 0.3
199 0.32
200 0.3
201 0.27
202 0.28
203 0.26
204 0.22
205 0.19
206 0.19
207 0.17
208 0.18
209 0.18
210 0.14
211 0.17
212 0.17
213 0.15
214 0.17
215 0.23
216 0.26
217 0.33
218 0.37
219 0.41
220 0.43
221 0.44
222 0.42
223 0.36
224 0.3
225 0.25
226 0.19
227 0.13
228 0.12
229 0.13
230 0.15
231 0.16
232 0.17
233 0.25
234 0.35
235 0.42
236 0.47
237 0.56
238 0.66
239 0.73
240 0.82
241 0.83
242 0.84
243 0.84
244 0.82
245 0.78
246 0.75
247 0.68
248 0.62
249 0.54
250 0.44
251 0.37
252 0.31
253 0.27
254 0.21
255 0.21
256 0.17
257 0.17
258 0.16
259 0.14
260 0.17