Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177DBZ2

Protein Details
Accession A0A177DBZ2    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
77-99DSTGTPKKTPTPRKRKAKGGAAAHydrophilic
107-130EADVKTPTKRGRKKKELGRDLTDEBasic
NLS Segment(s)
PositionSequence
83-122KKTPTPRKRKAKGGAAAAAAAAEGEADVKTPTKRGRKKKE
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
KEGG aalt:CC77DRAFT_1065080  -  
Amino Acid Sequences MSGNEGTKTGSGWTDKERLTYLFTLIENSNVKFDYNNTPRPAGRSIIACQRMIDRLKKAALKDEVEALTSGDPGTNDSTGTPKKTPTPRKRKAKGGAAAAAAAAEGEADVKTPTKRGRKKKELGRDLTDEEIVDGDLVEGETIGVKPEPKEEGQVGEDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.3
4 0.31
5 0.28
6 0.31
7 0.29
8 0.25
9 0.22
10 0.21
11 0.22
12 0.2
13 0.24
14 0.21
15 0.21
16 0.21
17 0.18
18 0.19
19 0.16
20 0.19
21 0.24
22 0.28
23 0.35
24 0.36
25 0.38
26 0.39
27 0.42
28 0.42
29 0.33
30 0.29
31 0.26
32 0.26
33 0.31
34 0.33
35 0.3
36 0.28
37 0.27
38 0.3
39 0.31
40 0.32
41 0.26
42 0.27
43 0.31
44 0.33
45 0.32
46 0.34
47 0.35
48 0.32
49 0.29
50 0.29
51 0.25
52 0.23
53 0.22
54 0.15
55 0.11
56 0.09
57 0.09
58 0.05
59 0.05
60 0.06
61 0.07
62 0.07
63 0.07
64 0.07
65 0.11
66 0.12
67 0.15
68 0.14
69 0.14
70 0.21
71 0.31
72 0.41
73 0.49
74 0.59
75 0.66
76 0.76
77 0.81
78 0.84
79 0.83
80 0.82
81 0.76
82 0.7
83 0.63
84 0.53
85 0.46
86 0.36
87 0.27
88 0.18
89 0.11
90 0.06
91 0.03
92 0.02
93 0.02
94 0.02
95 0.03
96 0.04
97 0.06
98 0.07
99 0.11
100 0.19
101 0.29
102 0.39
103 0.5
104 0.6
105 0.69
106 0.79
107 0.84
108 0.88
109 0.88
110 0.86
111 0.81
112 0.75
113 0.68
114 0.6
115 0.51
116 0.4
117 0.3
118 0.22
119 0.16
120 0.11
121 0.07
122 0.05
123 0.05
124 0.05
125 0.04
126 0.04
127 0.04
128 0.05
129 0.05
130 0.06
131 0.07
132 0.09
133 0.1
134 0.14
135 0.18
136 0.19
137 0.24
138 0.24
139 0.27