Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2WXI0

Protein Details
Accession G2WXI0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
305-337TPPTTPPTTCKAKRSRSRKARRSAKKVARRAQLHydrophilic
NLS Segment(s)
PositionSequence
315-335KAKRSRSRKARRSAKKVARRA
Subcellular Location(s) extr 19, cyto 3.5, mito 3, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005103  AA9  
Gene Ontology GO:0005576  C:extracellular region  
KEGG vda:VDAG_02959  -  
Pfam View protein in Pfam  
PF03443  AA9  
CDD cd21175  LPMO_AA9  
Amino Acid Sequences MRFTVASALAMATTVSAHAQMYGIWVNGVDQGDGRKDYIRSPPNNSPVKDLTSPDLVCGPNGGTPVPSFAKAAAGDKLSFEWYHDNRDDDIIDGSHAGPLITYIAEYTETDGSGPIWTKIAEDGYSGGKWAVDKIKANHGKQDFTLPASLAAGKYLVRQEIIAHHESDVAFASNPARGAQFYPSCVQLEVTEGGSAVPDEGFDFNTGYTSADPGIVFNLYSGYTSYTIPGPKVWTGAGSGSAPAPKPTTGAPVATTTAAAPVAPTTTAAPVVPAPGNGSEDDSEGAPAPRLLFHRPPSATNAPITPPTTPPTTCKAKRSRSRKARRSAKKVARRAQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.06
5 0.07
6 0.07
7 0.07
8 0.1
9 0.11
10 0.11
11 0.1
12 0.1
13 0.1
14 0.13
15 0.14
16 0.11
17 0.1
18 0.13
19 0.16
20 0.17
21 0.18
22 0.18
23 0.19
24 0.23
25 0.32
26 0.39
27 0.41
28 0.48
29 0.55
30 0.61
31 0.68
32 0.65
33 0.62
34 0.56
35 0.56
36 0.51
37 0.44
38 0.39
39 0.38
40 0.36
41 0.31
42 0.32
43 0.26
44 0.23
45 0.22
46 0.19
47 0.14
48 0.14
49 0.14
50 0.1
51 0.1
52 0.15
53 0.15
54 0.15
55 0.14
56 0.14
57 0.17
58 0.17
59 0.19
60 0.17
61 0.17
62 0.16
63 0.16
64 0.17
65 0.16
66 0.15
67 0.15
68 0.21
69 0.2
70 0.27
71 0.28
72 0.29
73 0.28
74 0.3
75 0.28
76 0.21
77 0.2
78 0.14
79 0.12
80 0.1
81 0.1
82 0.09
83 0.08
84 0.07
85 0.05
86 0.05
87 0.06
88 0.05
89 0.04
90 0.04
91 0.04
92 0.06
93 0.06
94 0.08
95 0.08
96 0.08
97 0.08
98 0.08
99 0.08
100 0.08
101 0.09
102 0.07
103 0.08
104 0.08
105 0.08
106 0.09
107 0.1
108 0.08
109 0.08
110 0.09
111 0.1
112 0.1
113 0.1
114 0.09
115 0.08
116 0.08
117 0.1
118 0.13
119 0.14
120 0.18
121 0.2
122 0.3
123 0.37
124 0.37
125 0.42
126 0.4
127 0.38
128 0.35
129 0.38
130 0.29
131 0.23
132 0.23
133 0.16
134 0.14
135 0.13
136 0.13
137 0.08
138 0.07
139 0.06
140 0.06
141 0.07
142 0.08
143 0.08
144 0.07
145 0.08
146 0.08
147 0.11
148 0.15
149 0.15
150 0.14
151 0.14
152 0.15
153 0.15
154 0.15
155 0.12
156 0.08
157 0.06
158 0.06
159 0.07
160 0.06
161 0.07
162 0.06
163 0.07
164 0.07
165 0.08
166 0.12
167 0.12
168 0.13
169 0.14
170 0.15
171 0.15
172 0.15
173 0.14
174 0.1
175 0.11
176 0.1
177 0.1
178 0.08
179 0.08
180 0.08
181 0.07
182 0.07
183 0.05
184 0.03
185 0.03
186 0.04
187 0.04
188 0.05
189 0.06
190 0.06
191 0.06
192 0.06
193 0.07
194 0.07
195 0.06
196 0.07
197 0.06
198 0.07
199 0.07
200 0.07
201 0.07
202 0.07
203 0.06
204 0.06
205 0.06
206 0.05
207 0.06
208 0.06
209 0.07
210 0.08
211 0.09
212 0.1
213 0.12
214 0.13
215 0.13
216 0.14
217 0.15
218 0.14
219 0.15
220 0.14
221 0.12
222 0.12
223 0.12
224 0.13
225 0.1
226 0.1
227 0.1
228 0.12
229 0.11
230 0.12
231 0.13
232 0.11
233 0.12
234 0.13
235 0.17
236 0.17
237 0.17
238 0.17
239 0.18
240 0.19
241 0.18
242 0.17
243 0.12
244 0.11
245 0.1
246 0.08
247 0.07
248 0.06
249 0.06
250 0.06
251 0.07
252 0.07
253 0.08
254 0.09
255 0.08
256 0.09
257 0.09
258 0.12
259 0.11
260 0.11
261 0.12
262 0.12
263 0.14
264 0.13
265 0.15
266 0.13
267 0.14
268 0.14
269 0.13
270 0.12
271 0.12
272 0.12
273 0.1
274 0.11
275 0.1
276 0.13
277 0.15
278 0.21
279 0.27
280 0.31
281 0.39
282 0.4
283 0.42
284 0.47
285 0.5
286 0.46
287 0.41
288 0.39
289 0.33
290 0.36
291 0.36
292 0.29
293 0.27
294 0.28
295 0.3
296 0.3
297 0.3
298 0.33
299 0.42
300 0.46
301 0.53
302 0.59
303 0.65
304 0.74
305 0.8
306 0.85
307 0.85
308 0.91
309 0.91
310 0.92
311 0.92
312 0.93
313 0.93
314 0.93
315 0.92
316 0.92
317 0.92