Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177DJ26

Protein Details
Accession A0A177DJ26    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
25-48APTPSGVRKHNRTHRNRHKEPTPTBasic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 10.5, extr 6, cyto 4.5
Family & Domain DBs
KEGG aalt:CC77DRAFT_1062375  -  
Amino Acid Sequences MATILFVTAAVATPYPWAAPQASLAPTPSGVRKHNRTHRNRHKEPTPTFKEGCECAMPVVPMNLLSANERCLMKQAAAMGCYLSSKGGCPSPAPACGLGPLPGIPMQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.09
5 0.09
6 0.1
7 0.11
8 0.14
9 0.15
10 0.15
11 0.16
12 0.15
13 0.15
14 0.16
15 0.18
16 0.19
17 0.23
18 0.3
19 0.36
20 0.46
21 0.55
22 0.63
23 0.69
24 0.76
25 0.82
26 0.85
27 0.85
28 0.82
29 0.8
30 0.79
31 0.76
32 0.75
33 0.71
34 0.65
35 0.58
36 0.52
37 0.47
38 0.38
39 0.34
40 0.24
41 0.17
42 0.12
43 0.12
44 0.11
45 0.09
46 0.09
47 0.07
48 0.06
49 0.06
50 0.06
51 0.06
52 0.08
53 0.08
54 0.09
55 0.12
56 0.12
57 0.11
58 0.14
59 0.15
60 0.13
61 0.14
62 0.17
63 0.16
64 0.16
65 0.16
66 0.13
67 0.12
68 0.12
69 0.11
70 0.08
71 0.07
72 0.07
73 0.1
74 0.13
75 0.14
76 0.14
77 0.2
78 0.22
79 0.24
80 0.26
81 0.24
82 0.22
83 0.22
84 0.23
85 0.18
86 0.17
87 0.14