Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177D9X0

Protein Details
Accession A0A177D9X0   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
70-89DIPDWEKKPHEPRDPRNWSKBasic
280-305GQSAPDPTLKRKRPEYNMFHTKKKKMHydrophilic
NLS Segment(s)
PositionSequence
301-304KKKK
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR010684  RNA_pol_II_trans_fac_SIII_A  
Gene Ontology GO:0070449  C:elongin complex  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG aalt:CC77DRAFT_1023891  -  
Pfam View protein in Pfam  
PF06881  Elongin_A  
Amino Acid Sequences MPVASLFELARQRLIKNIDMLRDVGDLPYSFLQPVLRFVQSPDQLLELEANCPQLLGETGEIWLRFIKRDIPDWEKKPHEPRDPRNWSKVYRKLKKDAELEKEADKEALKQQMQALQKDRAQNKTLIVETRFGYGAGASKMFTGRTTSSWGQPSGAPAKTGKAAFDKLKRGMFDHGRERPKASHIPQHLLEQRKTTVRQAPARMVRMAENEAPRSMVVSRQASASINNKPESRPTPSLSANRPNITQRPAPQQRNPPPPTRTSLPPGMSFSAPKPRAPNGQSAPDPTLKRKRPEYNMFHTKKKKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.37
4 0.4
5 0.38
6 0.38
7 0.38
8 0.33
9 0.31
10 0.27
11 0.2
12 0.18
13 0.14
14 0.15
15 0.16
16 0.15
17 0.14
18 0.15
19 0.17
20 0.15
21 0.2
22 0.21
23 0.2
24 0.2
25 0.23
26 0.31
27 0.3
28 0.31
29 0.28
30 0.25
31 0.24
32 0.24
33 0.24
34 0.15
35 0.15
36 0.13
37 0.14
38 0.12
39 0.12
40 0.11
41 0.09
42 0.09
43 0.09
44 0.09
45 0.08
46 0.09
47 0.11
48 0.12
49 0.12
50 0.13
51 0.12
52 0.13
53 0.14
54 0.2
55 0.2
56 0.27
57 0.33
58 0.39
59 0.47
60 0.51
61 0.58
62 0.56
63 0.61
64 0.64
65 0.66
66 0.68
67 0.69
68 0.73
69 0.76
70 0.81
71 0.8
72 0.79
73 0.75
74 0.71
75 0.71
76 0.72
77 0.72
78 0.72
79 0.73
80 0.73
81 0.75
82 0.76
83 0.75
84 0.73
85 0.69
86 0.65
87 0.6
88 0.53
89 0.48
90 0.4
91 0.33
92 0.25
93 0.2
94 0.19
95 0.24
96 0.21
97 0.22
98 0.23
99 0.28
100 0.31
101 0.32
102 0.32
103 0.29
104 0.32
105 0.38
106 0.4
107 0.39
108 0.38
109 0.36
110 0.33
111 0.32
112 0.31
113 0.27
114 0.24
115 0.22
116 0.2
117 0.19
118 0.18
119 0.14
120 0.13
121 0.1
122 0.1
123 0.09
124 0.08
125 0.07
126 0.07
127 0.08
128 0.08
129 0.08
130 0.09
131 0.09
132 0.1
133 0.16
134 0.17
135 0.2
136 0.22
137 0.22
138 0.2
139 0.19
140 0.21
141 0.19
142 0.18
143 0.16
144 0.14
145 0.15
146 0.17
147 0.17
148 0.15
149 0.13
150 0.17
151 0.21
152 0.26
153 0.29
154 0.3
155 0.33
156 0.32
157 0.31
158 0.34
159 0.34
160 0.35
161 0.38
162 0.42
163 0.45
164 0.45
165 0.46
166 0.41
167 0.41
168 0.43
169 0.38
170 0.38
171 0.37
172 0.41
173 0.4
174 0.45
175 0.45
176 0.43
177 0.41
178 0.36
179 0.36
180 0.35
181 0.36
182 0.34
183 0.35
184 0.37
185 0.42
186 0.43
187 0.49
188 0.5
189 0.51
190 0.47
191 0.41
192 0.36
193 0.32
194 0.32
195 0.28
196 0.25
197 0.24
198 0.23
199 0.22
200 0.2
201 0.19
202 0.16
203 0.14
204 0.17
205 0.17
206 0.17
207 0.18
208 0.19
209 0.18
210 0.22
211 0.24
212 0.24
213 0.27
214 0.29
215 0.3
216 0.3
217 0.36
218 0.37
219 0.4
220 0.39
221 0.38
222 0.41
223 0.46
224 0.52
225 0.51
226 0.56
227 0.54
228 0.51
229 0.51
230 0.51
231 0.5
232 0.48
233 0.47
234 0.43
235 0.48
236 0.56
237 0.61
238 0.63
239 0.69
240 0.74
241 0.79
242 0.79
243 0.76
244 0.71
245 0.68
246 0.67
247 0.61
248 0.57
249 0.53
250 0.56
251 0.51
252 0.49
253 0.48
254 0.44
255 0.41
256 0.37
257 0.35
258 0.38
259 0.36
260 0.36
261 0.38
262 0.4
263 0.48
264 0.48
265 0.54
266 0.49
267 0.56
268 0.55
269 0.55
270 0.54
271 0.52
272 0.53
273 0.52
274 0.57
275 0.56
276 0.62
277 0.67
278 0.72
279 0.75
280 0.82
281 0.82
282 0.82
283 0.85
284 0.83
285 0.83