Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177DQ74

Protein Details
Accession A0A177DQ74    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-49AQAPHTNQGRQSQRKPRGNRAHNGYNQNHHydrophilic
438-460QQSPNNRRRTPGRQPHQPRPDSNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
KEGG aalt:CC77DRAFT_1061044  -  
Pfam View protein in Pfam  
PF15365  PNRC  
Amino Acid Sequences MSTAQTTASPRAPRGKPQSPAQAPHTNQGRQSQRKPRGNRAHNGYNQNHHNGAGASPSKMPAELAHAEGAAYSGEDAQLPSGPRNMRKPNQSHPSIDRVFSPPESEPVPINPSATPAKVQAAYAGPTFHASPAPSALPIPKFLSRSVPAKTRAGPPTPPPEDSSDSASPSPSASPSRAPVAVPPRDEQSPLDLLFKADAAERAKGNHGRPLSYGALNPVDAARPQHFKHDSYHSTNGVFPIELDGESKHAHMSPPPVASPASHRSVTDPNQVPQLKDMQQQGNGNDVMQDLFNRLSMSQKKPSATPPRPDAQGPQGFSGQTPSPFHGGQHPAQNASGPTTPQTQPPNQDSDFFYGNRNLSPLFKAAKGDSAKKRNSGLRTEISAESPMVGQGDFQGFPSVPPAQMMDPNAFSRIQPGNGNGGHPNAPRSSTPFVQHYQQSPNNRRRTPGRQPHQPRPDSNQTRGNMPGPGKTAANGPPASAAKPLTSMMSFVPSSVAAKQRKTSAPAATASPMKTSTPSDTLSLEQDLKRLLNLNPAGESSVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.63
4 0.68
5 0.74
6 0.71
7 0.74
8 0.71
9 0.71
10 0.65
11 0.67
12 0.67
13 0.59
14 0.56
15 0.59
16 0.62
17 0.62
18 0.7
19 0.72
20 0.75
21 0.81
22 0.85
23 0.87
24 0.88
25 0.87
26 0.87
27 0.85
28 0.84
29 0.82
30 0.84
31 0.78
32 0.76
33 0.73
34 0.68
35 0.6
36 0.5
37 0.44
38 0.35
39 0.29
40 0.28
41 0.24
42 0.2
43 0.2
44 0.22
45 0.2
46 0.2
47 0.2
48 0.13
49 0.18
50 0.18
51 0.19
52 0.18
53 0.17
54 0.17
55 0.16
56 0.15
57 0.09
58 0.07
59 0.05
60 0.05
61 0.05
62 0.06
63 0.06
64 0.06
65 0.1
66 0.11
67 0.12
68 0.18
69 0.22
70 0.28
71 0.37
72 0.46
73 0.5
74 0.59
75 0.64
76 0.68
77 0.73
78 0.73
79 0.7
80 0.65
81 0.67
82 0.6
83 0.54
84 0.47
85 0.41
86 0.4
87 0.34
88 0.33
89 0.25
90 0.25
91 0.25
92 0.23
93 0.21
94 0.2
95 0.24
96 0.2
97 0.21
98 0.18
99 0.21
100 0.22
101 0.22
102 0.2
103 0.18
104 0.21
105 0.2
106 0.2
107 0.19
108 0.18
109 0.19
110 0.18
111 0.17
112 0.14
113 0.14
114 0.15
115 0.13
116 0.12
117 0.11
118 0.11
119 0.13
120 0.14
121 0.12
122 0.13
123 0.17
124 0.16
125 0.18
126 0.21
127 0.22
128 0.23
129 0.24
130 0.29
131 0.29
132 0.32
133 0.34
134 0.37
135 0.37
136 0.39
137 0.42
138 0.43
139 0.45
140 0.44
141 0.44
142 0.43
143 0.49
144 0.48
145 0.46
146 0.4
147 0.4
148 0.41
149 0.38
150 0.39
151 0.31
152 0.3
153 0.29
154 0.27
155 0.22
156 0.18
157 0.17
158 0.13
159 0.14
160 0.14
161 0.15
162 0.17
163 0.2
164 0.2
165 0.19
166 0.22
167 0.28
168 0.31
169 0.31
170 0.3
171 0.3
172 0.3
173 0.32
174 0.26
175 0.22
176 0.21
177 0.2
178 0.2
179 0.17
180 0.17
181 0.16
182 0.15
183 0.11
184 0.09
185 0.12
186 0.11
187 0.13
188 0.13
189 0.15
190 0.2
191 0.24
192 0.25
193 0.27
194 0.26
195 0.25
196 0.25
197 0.29
198 0.26
199 0.22
200 0.21
201 0.18
202 0.18
203 0.17
204 0.16
205 0.11
206 0.1
207 0.09
208 0.11
209 0.12
210 0.15
211 0.16
212 0.24
213 0.26
214 0.27
215 0.31
216 0.36
217 0.39
218 0.41
219 0.44
220 0.37
221 0.36
222 0.35
223 0.32
224 0.24
225 0.18
226 0.12
227 0.09
228 0.09
229 0.08
230 0.08
231 0.07
232 0.08
233 0.09
234 0.09
235 0.08
236 0.08
237 0.08
238 0.09
239 0.13
240 0.14
241 0.15
242 0.15
243 0.16
244 0.15
245 0.15
246 0.19
247 0.19
248 0.2
249 0.19
250 0.19
251 0.21
252 0.26
253 0.29
254 0.32
255 0.3
256 0.27
257 0.34
258 0.35
259 0.32
260 0.28
261 0.3
262 0.24
263 0.26
264 0.29
265 0.24
266 0.27
267 0.28
268 0.28
269 0.26
270 0.24
271 0.2
272 0.15
273 0.13
274 0.1
275 0.08
276 0.08
277 0.06
278 0.06
279 0.06
280 0.06
281 0.06
282 0.12
283 0.18
284 0.23
285 0.28
286 0.31
287 0.32
288 0.33
289 0.42
290 0.47
291 0.48
292 0.49
293 0.47
294 0.47
295 0.48
296 0.47
297 0.41
298 0.39
299 0.37
300 0.33
301 0.29
302 0.27
303 0.25
304 0.24
305 0.24
306 0.17
307 0.15
308 0.15
309 0.15
310 0.17
311 0.17
312 0.17
313 0.2
314 0.23
315 0.23
316 0.29
317 0.28
318 0.26
319 0.26
320 0.27
321 0.21
322 0.2
323 0.19
324 0.12
325 0.13
326 0.17
327 0.17
328 0.21
329 0.26
330 0.26
331 0.31
332 0.33
333 0.38
334 0.34
335 0.36
336 0.33
337 0.31
338 0.3
339 0.26
340 0.25
341 0.23
342 0.23
343 0.2
344 0.19
345 0.16
346 0.15
347 0.16
348 0.18
349 0.16
350 0.16
351 0.18
352 0.18
353 0.24
354 0.26
355 0.33
356 0.38
357 0.45
358 0.47
359 0.48
360 0.53
361 0.52
362 0.54
363 0.51
364 0.48
365 0.43
366 0.43
367 0.43
368 0.39
369 0.34
370 0.3
371 0.24
372 0.19
373 0.15
374 0.12
375 0.09
376 0.08
377 0.06
378 0.07
379 0.09
380 0.08
381 0.09
382 0.1
383 0.1
384 0.1
385 0.14
386 0.13
387 0.11
388 0.12
389 0.13
390 0.12
391 0.15
392 0.17
393 0.16
394 0.17
395 0.18
396 0.19
397 0.18
398 0.17
399 0.2
400 0.2
401 0.2
402 0.2
403 0.21
404 0.26
405 0.26
406 0.28
407 0.24
408 0.24
409 0.26
410 0.24
411 0.25
412 0.2
413 0.22
414 0.21
415 0.26
416 0.29
417 0.28
418 0.31
419 0.33
420 0.34
421 0.37
422 0.41
423 0.39
424 0.43
425 0.46
426 0.52
427 0.58
428 0.65
429 0.69
430 0.67
431 0.68
432 0.68
433 0.71
434 0.72
435 0.74
436 0.73
437 0.75
438 0.82
439 0.87
440 0.89
441 0.86
442 0.8
443 0.78
444 0.8
445 0.76
446 0.74
447 0.71
448 0.61
449 0.58
450 0.57
451 0.5
452 0.44
453 0.38
454 0.36
455 0.31
456 0.32
457 0.29
458 0.26
459 0.28
460 0.27
461 0.32
462 0.28
463 0.24
464 0.28
465 0.29
466 0.29
467 0.27
468 0.24
469 0.18
470 0.2
471 0.2
472 0.17
473 0.16
474 0.16
475 0.14
476 0.18
477 0.17
478 0.15
479 0.16
480 0.14
481 0.15
482 0.19
483 0.26
484 0.27
485 0.31
486 0.35
487 0.42
488 0.46
489 0.5
490 0.51
491 0.5
492 0.49
493 0.47
494 0.46
495 0.42
496 0.42
497 0.37
498 0.34
499 0.29
500 0.25
501 0.26
502 0.27
503 0.28
504 0.28
505 0.29
506 0.28
507 0.29
508 0.3
509 0.3
510 0.3
511 0.3
512 0.26
513 0.27
514 0.27
515 0.26
516 0.26
517 0.27
518 0.24
519 0.28
520 0.31
521 0.3
522 0.29
523 0.3