Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2X9V6

Protein Details
Accession G2X9V6    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
84-103DENCWEKRVRSQPRAEKADVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, cyto_mito 10.499, cyto_nucl 7.333, cyto 7, nucl 4.5
Family & Domain DBs
KEGG vda:VDAG_07151  -  
Amino Acid Sequences MATEQSLRHATVSGPPGLHNVPSCGHAAPKSCLLALPEVLPVTLGSQGCSPCRRAAAASSWCNGNVEPVGAERGVAGAQVVTSDENCWEKRVRSQPRAEKADVGHWQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.24
4 0.24
5 0.25
6 0.19
7 0.18
8 0.16
9 0.18
10 0.19
11 0.16
12 0.17
13 0.17
14 0.2
15 0.2
16 0.22
17 0.21
18 0.19
19 0.2
20 0.19
21 0.18
22 0.15
23 0.13
24 0.11
25 0.1
26 0.1
27 0.09
28 0.08
29 0.07
30 0.09
31 0.08
32 0.08
33 0.1
34 0.11
35 0.13
36 0.15
37 0.16
38 0.14
39 0.15
40 0.14
41 0.13
42 0.14
43 0.19
44 0.24
45 0.24
46 0.24
47 0.24
48 0.24
49 0.23
50 0.21
51 0.16
52 0.09
53 0.07
54 0.07
55 0.07
56 0.08
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.05
63 0.04
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.05
70 0.06
71 0.08
72 0.12
73 0.13
74 0.16
75 0.19
76 0.21
77 0.3
78 0.4
79 0.48
80 0.53
81 0.63
82 0.7
83 0.77
84 0.82
85 0.75
86 0.7
87 0.62
88 0.62