Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177E0K3

Protein Details
Accession A0A177E0K3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
100-126CPRPLLPTRPRPPRSRPPRSLSSPRSNHydrophilic
NLS Segment(s)
PositionSequence
110-116RPPRSRP
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
KEGG aalt:CC77DRAFT_543203  -  
Amino Acid Sequences MVTLPARSIQARSRVNRWAVSWLWIDASMSRAPLSGAPHGSGKVRLGFTYRITTLSILHSAAVGPAHSLSGTIETDCPPARPLTSSAAYKPAGISIRALCPRPLLPTRPRPPRSRPPRSLSSPRSNISLTRDPPGCRYMVYGCRVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.54
4 0.5
5 0.47
6 0.39
7 0.39
8 0.35
9 0.28
10 0.24
11 0.21
12 0.2
13 0.14
14 0.16
15 0.13
16 0.12
17 0.11
18 0.1
19 0.1
20 0.12
21 0.15
22 0.15
23 0.16
24 0.17
25 0.18
26 0.19
27 0.19
28 0.19
29 0.17
30 0.18
31 0.17
32 0.16
33 0.18
34 0.19
35 0.2
36 0.23
37 0.22
38 0.19
39 0.19
40 0.19
41 0.17
42 0.16
43 0.15
44 0.11
45 0.1
46 0.09
47 0.08
48 0.08
49 0.07
50 0.05
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.05
58 0.06
59 0.06
60 0.06
61 0.07
62 0.09
63 0.09
64 0.1
65 0.09
66 0.09
67 0.09
68 0.1
69 0.12
70 0.15
71 0.18
72 0.18
73 0.18
74 0.22
75 0.22
76 0.21
77 0.19
78 0.17
79 0.16
80 0.15
81 0.16
82 0.13
83 0.19
84 0.21
85 0.23
86 0.2
87 0.21
88 0.22
89 0.26
90 0.28
91 0.29
92 0.35
93 0.45
94 0.54
95 0.62
96 0.67
97 0.68
98 0.73
99 0.77
100 0.8
101 0.8
102 0.8
103 0.76
104 0.79
105 0.81
106 0.82
107 0.8
108 0.8
109 0.76
110 0.69
111 0.65
112 0.57
113 0.51
114 0.49
115 0.49
116 0.41
117 0.41
118 0.44
119 0.42
120 0.44
121 0.44
122 0.37
123 0.29
124 0.3
125 0.31
126 0.34