Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177E0Z8

Protein Details
Accession A0A177E0Z8   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MEERLKRRRNSRTWRGGIAHBasic
62-82IKPFSERRKKERKQTRLQVLYHydrophilic
NLS Segment(s)
PositionSequence
68-73RRKKER
Subcellular Location(s) mito 9.5, cyto_mito 9.5, cyto 8.5, nucl 6
Family & Domain DBs
KEGG aalt:CC77DRAFT_318698  -  
Amino Acid Sequences MEERLKRRRNSRTWRGGIAHAMVGKLTSRSFSRIPSVLLYLASFVLADCPTHLPATLVSATIKPFSERRKKERKQTRLQVLYVDERGWGCNEGLEDDVGNSALGSATVAPCPIETSSERQSVIVSLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.76
3 0.69
4 0.62
5 0.53
6 0.44
7 0.34
8 0.28
9 0.21
10 0.18
11 0.15
12 0.13
13 0.11
14 0.1
15 0.11
16 0.15
17 0.17
18 0.19
19 0.23
20 0.23
21 0.24
22 0.23
23 0.24
24 0.2
25 0.19
26 0.16
27 0.12
28 0.1
29 0.09
30 0.07
31 0.05
32 0.06
33 0.06
34 0.06
35 0.06
36 0.08
37 0.09
38 0.09
39 0.09
40 0.08
41 0.08
42 0.1
43 0.1
44 0.09
45 0.08
46 0.09
47 0.1
48 0.1
49 0.1
50 0.09
51 0.12
52 0.2
53 0.3
54 0.35
55 0.44
56 0.54
57 0.61
58 0.7
59 0.77
60 0.79
61 0.79
62 0.83
63 0.85
64 0.79
65 0.74
66 0.66
67 0.58
68 0.52
69 0.42
70 0.32
71 0.23
72 0.17
73 0.17
74 0.15
75 0.13
76 0.09
77 0.09
78 0.1
79 0.1
80 0.1
81 0.1
82 0.08
83 0.07
84 0.08
85 0.07
86 0.06
87 0.05
88 0.04
89 0.04
90 0.04
91 0.04
92 0.05
93 0.05
94 0.06
95 0.06
96 0.07
97 0.07
98 0.09
99 0.09
100 0.12
101 0.14
102 0.2
103 0.26
104 0.29
105 0.3
106 0.28
107 0.28