Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177DVN6

Protein Details
Accession A0A177DVN6    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
196-218EMEKARKRKPLTKGELKNRHAQEBasic
NLS Segment(s)
PositionSequence
199-217KARKRKPLTKGELKNRHAQ
241-260KGKPYRRVGHVKREPGWESK
Subcellular Location(s) nucl 8mito 8mito_nucl 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
KEGG aalt:CC77DRAFT_1038250  -  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
Amino Acid Sequences MSSSQRYRRPAKDEPTDTTTSSIPPTATGAKEKAELKQAVKEQAVATSNGVSMLDVLRILGGVLLLSCGLSYLSTSGESMTWGYNPWWTRAREWKSLMQGEVILTDSELALYNGADPSKPIYLALNGTIYDVSISPTTYGPGGSYHFFAGKDAARAFLTGCFAEDSVPDLRGVEQMFIPIDPEEKVSLTPQEREIEMEKARKRKPLTKGELKNRHAQELKSARKQMVAGLEGWHMLFRGDKGKPYRRVGHVKREPGWESKMPKRGLCEQAEKGRPVRKYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.71
3 0.66
4 0.59
5 0.52
6 0.43
7 0.34
8 0.3
9 0.25
10 0.18
11 0.16
12 0.18
13 0.2
14 0.22
15 0.24
16 0.25
17 0.25
18 0.3
19 0.3
20 0.3
21 0.34
22 0.37
23 0.34
24 0.4
25 0.42
26 0.43
27 0.42
28 0.41
29 0.33
30 0.33
31 0.33
32 0.26
33 0.22
34 0.18
35 0.17
36 0.15
37 0.14
38 0.09
39 0.08
40 0.07
41 0.07
42 0.06
43 0.06
44 0.05
45 0.05
46 0.05
47 0.04
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.05
61 0.06
62 0.06
63 0.07
64 0.06
65 0.07
66 0.08
67 0.08
68 0.07
69 0.08
70 0.08
71 0.13
72 0.14
73 0.17
74 0.22
75 0.23
76 0.28
77 0.37
78 0.43
79 0.45
80 0.48
81 0.49
82 0.5
83 0.51
84 0.46
85 0.37
86 0.31
87 0.24
88 0.21
89 0.16
90 0.09
91 0.07
92 0.06
93 0.05
94 0.05
95 0.05
96 0.05
97 0.04
98 0.04
99 0.05
100 0.05
101 0.06
102 0.05
103 0.05
104 0.07
105 0.08
106 0.08
107 0.08
108 0.08
109 0.09
110 0.1
111 0.1
112 0.09
113 0.08
114 0.09
115 0.08
116 0.07
117 0.07
118 0.06
119 0.06
120 0.05
121 0.05
122 0.06
123 0.06
124 0.07
125 0.06
126 0.06
127 0.06
128 0.06
129 0.08
130 0.08
131 0.08
132 0.09
133 0.1
134 0.1
135 0.09
136 0.11
137 0.1
138 0.11
139 0.11
140 0.12
141 0.1
142 0.11
143 0.11
144 0.1
145 0.1
146 0.08
147 0.08
148 0.07
149 0.07
150 0.07
151 0.07
152 0.09
153 0.08
154 0.09
155 0.08
156 0.08
157 0.09
158 0.1
159 0.11
160 0.09
161 0.08
162 0.08
163 0.09
164 0.08
165 0.09
166 0.07
167 0.07
168 0.07
169 0.08
170 0.08
171 0.08
172 0.09
173 0.09
174 0.15
175 0.16
176 0.17
177 0.19
178 0.2
179 0.2
180 0.22
181 0.23
182 0.23
183 0.25
184 0.31
185 0.33
186 0.4
187 0.43
188 0.48
189 0.52
190 0.55
191 0.6
192 0.64
193 0.68
194 0.7
195 0.77
196 0.81
197 0.86
198 0.81
199 0.81
200 0.72
201 0.7
202 0.63
203 0.53
204 0.53
205 0.53
206 0.57
207 0.56
208 0.58
209 0.51
210 0.5
211 0.5
212 0.43
213 0.39
214 0.32
215 0.24
216 0.22
217 0.22
218 0.19
219 0.19
220 0.15
221 0.1
222 0.08
223 0.09
224 0.09
225 0.15
226 0.17
227 0.24
228 0.33
229 0.43
230 0.51
231 0.58
232 0.64
233 0.66
234 0.76
235 0.77
236 0.79
237 0.79
238 0.79
239 0.76
240 0.75
241 0.7
242 0.65
243 0.64
244 0.6
245 0.58
246 0.58
247 0.61
248 0.58
249 0.57
250 0.57
251 0.6
252 0.61
253 0.6
254 0.6
255 0.6
256 0.65
257 0.7
258 0.67
259 0.65
260 0.63