Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177E3H8

Protein Details
Accession A0A177E3H8   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
85-105KKLCDGCKSVRRKKGRYVYIIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG aalt:CC77DRAFT_1090376  -  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MLSRALTTAFRRPCSTQTLRTTLRTRTQHIHTPTCSCVRPTLSTFRAQASQQSNYGIRDLVSGFNGLSMGGRIQTRGMKVRSSVKKLCDGCKSVRRKKGRYVYIICSKNPKHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.5
3 0.5
4 0.52
5 0.56
6 0.56
7 0.59
8 0.6
9 0.57
10 0.6
11 0.55
12 0.53
13 0.52
14 0.53
15 0.55
16 0.57
17 0.57
18 0.51
19 0.5
20 0.48
21 0.46
22 0.41
23 0.34
24 0.31
25 0.28
26 0.29
27 0.29
28 0.33
29 0.31
30 0.34
31 0.33
32 0.31
33 0.3
34 0.27
35 0.3
36 0.26
37 0.26
38 0.23
39 0.24
40 0.23
41 0.22
42 0.22
43 0.16
44 0.11
45 0.1
46 0.1
47 0.08
48 0.07
49 0.07
50 0.06
51 0.06
52 0.06
53 0.05
54 0.04
55 0.04
56 0.04
57 0.05
58 0.05
59 0.06
60 0.08
61 0.1
62 0.13
63 0.19
64 0.2
65 0.2
66 0.23
67 0.33
68 0.39
69 0.44
70 0.47
71 0.44
72 0.51
73 0.53
74 0.56
75 0.53
76 0.5
77 0.51
78 0.55
79 0.62
80 0.63
81 0.69
82 0.73
83 0.72
84 0.78
85 0.8
86 0.8
87 0.8
88 0.77
89 0.76
90 0.76
91 0.75
92 0.67
93 0.66
94 0.63
95 0.64
96 0.68
97 0.7