Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177DLP3

Protein Details
Accession A0A177DLP3    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
91-110KRLLRARSSRDGAKKRPRSFBasic
NLS Segment(s)
PositionSequence
92-109RLLRARSSRDGAKKRPRS
Subcellular Location(s) plas 9, extr 6, mito 3, E.R. 3, nucl 2, cyto_mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG aalt:CC77DRAFT_136221  -  
Amino Acid Sequences MHLQSPVDYHHYYRDRHVVVRCAPFFFKQMSGSFRFGSAAVVTKLAASLIVLAIEHQSSLHFRWRAFATNFSSSRRGLEIDGELSLQPQAKRLLRARSSRDGAKKRPRSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.46
4 0.49
5 0.47
6 0.48
7 0.55
8 0.51
9 0.45
10 0.45
11 0.4
12 0.38
13 0.33
14 0.28
15 0.22
16 0.24
17 0.26
18 0.28
19 0.29
20 0.27
21 0.25
22 0.24
23 0.21
24 0.19
25 0.14
26 0.12
27 0.1
28 0.1
29 0.1
30 0.09
31 0.08
32 0.07
33 0.06
34 0.04
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.04
41 0.04
42 0.04
43 0.03
44 0.04
45 0.05
46 0.07
47 0.13
48 0.15
49 0.15
50 0.19
51 0.2
52 0.26
53 0.26
54 0.3
55 0.29
56 0.34
57 0.36
58 0.35
59 0.36
60 0.31
61 0.31
62 0.27
63 0.23
64 0.17
65 0.17
66 0.16
67 0.14
68 0.14
69 0.13
70 0.12
71 0.11
72 0.12
73 0.13
74 0.11
75 0.14
76 0.2
77 0.22
78 0.3
79 0.36
80 0.44
81 0.49
82 0.57
83 0.62
84 0.64
85 0.67
86 0.68
87 0.73
88 0.72
89 0.75
90 0.77