Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177DE33

Protein Details
Accession A0A177DE33    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
51-71RYSSSKPSTPPNSKKKPAELDHydrophilic
276-311MYMISVKRQRKLKMKKHKYKKLMKRTRLLRRKLDRTBasic
NLS Segment(s)
PositionSequence
83-89RRSKETK
282-310KRQRKLKMKKHKYKKLMKRTRLLRRKLDR
Subcellular Location(s) nucl 13, mito 13, mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
KEGG aalt:CC77DRAFT_941628  -  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MFSPAVGRVARSANTLAAAPANSFVFTRCARSALSTSTAPQQPFRPSHQRRYSSSKPSTPPNSKKKPAELDQNATAELRGAGRRSKETKKLKEPSTATTGNNVPFVPPTNHLREDDVKLSAFFGLHRPISISRSFPSSTSTAEFDAFFDVNRANDVQRMEATKDVLSGFLDRVHAEIDAQEEQRADAIQSEQRIIHVDFQPTKENIEDLAARLVPFQPPPAPDLNDPIYSATESESRSAEDLSASINQRITEVPLPSEQDRPSTFREHVARRRYGMYMISVKRQRKLKMKKHKYKKLMKRTRLLRRKLDRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.17
4 0.16
5 0.15
6 0.13
7 0.13
8 0.13
9 0.12
10 0.12
11 0.12
12 0.15
13 0.16
14 0.21
15 0.2
16 0.22
17 0.22
18 0.26
19 0.28
20 0.27
21 0.3
22 0.25
23 0.26
24 0.32
25 0.36
26 0.33
27 0.33
28 0.34
29 0.38
30 0.41
31 0.47
32 0.51
33 0.54
34 0.63
35 0.7
36 0.72
37 0.7
38 0.75
39 0.76
40 0.75
41 0.76
42 0.73
43 0.67
44 0.7
45 0.74
46 0.75
47 0.76
48 0.77
49 0.78
50 0.79
51 0.81
52 0.81
53 0.79
54 0.75
55 0.76
56 0.72
57 0.69
58 0.65
59 0.59
60 0.51
61 0.42
62 0.35
63 0.25
64 0.18
65 0.14
66 0.11
67 0.12
68 0.15
69 0.18
70 0.25
71 0.31
72 0.38
73 0.46
74 0.54
75 0.62
76 0.69
77 0.75
78 0.73
79 0.75
80 0.71
81 0.65
82 0.62
83 0.56
84 0.46
85 0.41
86 0.39
87 0.31
88 0.3
89 0.25
90 0.18
91 0.16
92 0.18
93 0.16
94 0.16
95 0.2
96 0.24
97 0.27
98 0.27
99 0.3
100 0.31
101 0.32
102 0.31
103 0.27
104 0.22
105 0.2
106 0.19
107 0.16
108 0.12
109 0.09
110 0.1
111 0.11
112 0.11
113 0.11
114 0.12
115 0.13
116 0.16
117 0.17
118 0.17
119 0.14
120 0.18
121 0.19
122 0.17
123 0.19
124 0.17
125 0.17
126 0.17
127 0.17
128 0.14
129 0.14
130 0.14
131 0.11
132 0.12
133 0.1
134 0.08
135 0.08
136 0.08
137 0.07
138 0.07
139 0.08
140 0.06
141 0.09
142 0.09
143 0.09
144 0.1
145 0.12
146 0.12
147 0.12
148 0.13
149 0.11
150 0.11
151 0.1
152 0.1
153 0.08
154 0.08
155 0.08
156 0.08
157 0.08
158 0.07
159 0.08
160 0.08
161 0.07
162 0.06
163 0.06
164 0.08
165 0.09
166 0.1
167 0.1
168 0.1
169 0.09
170 0.1
171 0.1
172 0.07
173 0.06
174 0.08
175 0.09
176 0.1
177 0.11
178 0.11
179 0.11
180 0.14
181 0.14
182 0.17
183 0.18
184 0.22
185 0.23
186 0.26
187 0.3
188 0.27
189 0.28
190 0.23
191 0.2
192 0.16
193 0.16
194 0.14
195 0.1
196 0.12
197 0.11
198 0.11
199 0.11
200 0.12
201 0.11
202 0.11
203 0.12
204 0.13
205 0.13
206 0.17
207 0.2
208 0.22
209 0.21
210 0.26
211 0.27
212 0.25
213 0.25
214 0.23
215 0.2
216 0.17
217 0.17
218 0.13
219 0.13
220 0.13
221 0.14
222 0.13
223 0.13
224 0.14
225 0.14
226 0.13
227 0.1
228 0.09
229 0.1
230 0.14
231 0.15
232 0.15
233 0.17
234 0.16
235 0.17
236 0.17
237 0.2
238 0.19
239 0.19
240 0.19
241 0.21
242 0.25
243 0.26
244 0.3
245 0.27
246 0.28
247 0.3
248 0.32
249 0.33
250 0.34
251 0.34
252 0.37
253 0.44
254 0.48
255 0.54
256 0.59
257 0.6
258 0.58
259 0.6
260 0.54
261 0.48
262 0.41
263 0.39
264 0.39
265 0.37
266 0.44
267 0.48
268 0.51
269 0.55
270 0.6
271 0.62
272 0.63
273 0.72
274 0.73
275 0.77
276 0.84
277 0.88
278 0.92
279 0.95
280 0.95
281 0.95
282 0.95
283 0.95
284 0.94
285 0.93
286 0.92
287 0.92
288 0.92
289 0.92
290 0.9
291 0.89