Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177DB29

Protein Details
Accession A0A177DB29   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
111-132VKKQVKCKFCRKYISEKAKRCVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, extr 6, mito 5, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037673  MSC/AndL  
IPR036019  MscL_channel  
Gene Ontology GO:0016020  C:membrane  
KEGG aalt:CC77DRAFT_944180  -  
Pfam View protein in Pfam  
PF01741  MscL  
Amino Acid Sequences TSTVLIQTTSLAASFTACANSLVSSIILPIISLLPFISRNLDSKFAILQSGPNYNVSISNGYNTPKQAIDDGAVVLAYGDFLDKIIRFLAIALALWVIALAYSRGSGDNIVKKQVKCKFCRKYISEKAKRCVNCTSWVDGREDRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.09
5 0.09
6 0.09
7 0.1
8 0.09
9 0.09
10 0.09
11 0.08
12 0.07
13 0.07
14 0.06
15 0.05
16 0.06
17 0.06
18 0.05
19 0.06
20 0.05
21 0.06
22 0.07
23 0.08
24 0.11
25 0.11
26 0.15
27 0.17
28 0.2
29 0.19
30 0.19
31 0.2
32 0.17
33 0.16
34 0.13
35 0.13
36 0.12
37 0.15
38 0.15
39 0.15
40 0.15
41 0.14
42 0.15
43 0.14
44 0.14
45 0.11
46 0.11
47 0.12
48 0.13
49 0.15
50 0.14
51 0.14
52 0.12
53 0.13
54 0.12
55 0.11
56 0.1
57 0.09
58 0.08
59 0.07
60 0.06
61 0.05
62 0.05
63 0.04
64 0.03
65 0.02
66 0.02
67 0.02
68 0.02
69 0.04
70 0.04
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.06
77 0.05
78 0.05
79 0.04
80 0.04
81 0.04
82 0.04
83 0.03
84 0.02
85 0.02
86 0.03
87 0.03
88 0.03
89 0.03
90 0.04
91 0.05
92 0.06
93 0.08
94 0.13
95 0.2
96 0.21
97 0.29
98 0.34
99 0.34
100 0.43
101 0.49
102 0.53
103 0.53
104 0.63
105 0.65
106 0.68
107 0.77
108 0.74
109 0.77
110 0.79
111 0.83
112 0.82
113 0.81
114 0.8
115 0.79
116 0.76
117 0.69
118 0.66
119 0.59
120 0.58
121 0.53
122 0.53
123 0.5
124 0.49
125 0.51