Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XF79

Protein Details
Accession G2XF79   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-33GDSTLIPPRKQERKRFKPTSRPRPPIPGQHydrophilic
NLS Segment(s)
PositionSequence
12-29PRKQERKRFKPTSRPRPP
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010997  HRDC-like_sf  
IPR006590  RNA_pol_Rpb4/RPC9_core  
IPR045222  Rpb4-like  
IPR005574  Rpb4/RPC9  
IPR038324  Rpb4/RPC9_sf  
Gene Ontology GO:0000932  C:P-body  
GO:0005665  C:RNA polymerase II, core complex  
GO:1990328  C:RPB4-RPB7 complex  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0000166  F:nucleotide binding  
GO:0003968  F:RNA-dependent RNA polymerase activity  
GO:0003697  F:single-stranded DNA binding  
GO:0003727  F:single-stranded RNA binding  
GO:0031369  F:translation initiation factor binding  
GO:0031990  P:mRNA export from nucleus in response to heat stress  
GO:0000288  P:nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay  
GO:0045948  P:positive regulation of translational initiation  
GO:0034402  P:recruitment of 3'-end processing factors to RNA polymerase II holoenzyme complex  
GO:0006368  P:transcription elongation by RNA polymerase II  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
KEGG vda:VDAG_08811  -  
Pfam View protein in Pfam  
PF03874  RNA_pol_Rpb4  
Amino Acid Sequences MADQGDSTLIPPRKQERKRFKPTSRPRPPIPGQEKAEAVLELGEFQEVDTLTLSEASLVINALVTKRRMDRKNVNETEMLTQTLNYLDAFSRFRQKENVEAVERLLSAHKQLAKFERAQIGSLCCETAEEAKTLIPSLQDKITDEDLQELLDEISKLQSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.66
3 0.68
4 0.76
5 0.85
6 0.9
7 0.9
8 0.91
9 0.93
10 0.94
11 0.93
12 0.9
13 0.84
14 0.83
15 0.79
16 0.79
17 0.75
18 0.72
19 0.65
20 0.61
21 0.57
22 0.48
23 0.43
24 0.32
25 0.25
26 0.16
27 0.11
28 0.08
29 0.07
30 0.06
31 0.05
32 0.04
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.07
40 0.06
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.03
47 0.04
48 0.04
49 0.05
50 0.07
51 0.08
52 0.1
53 0.15
54 0.24
55 0.27
56 0.35
57 0.44
58 0.5
59 0.6
60 0.6
61 0.57
62 0.5
63 0.48
64 0.43
65 0.34
66 0.26
67 0.15
68 0.13
69 0.11
70 0.1
71 0.09
72 0.06
73 0.06
74 0.05
75 0.07
76 0.09
77 0.1
78 0.19
79 0.19
80 0.21
81 0.25
82 0.26
83 0.31
84 0.35
85 0.38
86 0.32
87 0.32
88 0.31
89 0.27
90 0.25
91 0.19
92 0.15
93 0.1
94 0.09
95 0.13
96 0.15
97 0.15
98 0.19
99 0.24
100 0.27
101 0.28
102 0.31
103 0.34
104 0.31
105 0.32
106 0.3
107 0.27
108 0.25
109 0.24
110 0.2
111 0.13
112 0.13
113 0.12
114 0.14
115 0.13
116 0.11
117 0.12
118 0.12
119 0.13
120 0.13
121 0.13
122 0.12
123 0.13
124 0.15
125 0.17
126 0.18
127 0.19
128 0.23
129 0.27
130 0.25
131 0.24
132 0.24
133 0.21
134 0.2
135 0.18
136 0.15
137 0.1
138 0.11
139 0.11
140 0.08