Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177DSE8

Protein Details
Accession A0A177DSE8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
8-27GTNPIHNKQKKKKAVELDEDHydrophilic
NLS Segment(s)
PositionSequence
50-69GKGKGPLNTGSQGIKKSGKK
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
KEGG aalt:CC77DRAFT_1060049  -  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MPSGQGAGTNPIHNKQKKKKAVELDEDDIAYKAKLAAEKKQREDLAKTVGKGKGPLNTGSQGIKKSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.57
3 0.65
4 0.71
5 0.76
6 0.78
7 0.79
8 0.8
9 0.79
10 0.75
11 0.67
12 0.59
13 0.51
14 0.43
15 0.33
16 0.25
17 0.16
18 0.09
19 0.06
20 0.06
21 0.09
22 0.11
23 0.18
24 0.28
25 0.34
26 0.37
27 0.43
28 0.44
29 0.44
30 0.46
31 0.42
32 0.41
33 0.38
34 0.35
35 0.35
36 0.35
37 0.33
38 0.33
39 0.32
40 0.29
41 0.29
42 0.3
43 0.29
44 0.29
45 0.3
46 0.31
47 0.32
48 0.29
49 0.31