Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177DPM1

Protein Details
Accession A0A177DPM1    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MPKALHFKGDKKVKKRRKAADPYDADEKBasic
NLS Segment(s)
PositionSequence
8-19KGDKKVKKRRKA
204-214KPRLKASKEEK
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008999  Actin-crosslinking  
IPR010414  FRG1  
Gene Ontology GO:0005730  C:nucleolus  
KEGG aalt:CC77DRAFT_801712  -  
Pfam View protein in Pfam  
PF06229  FRG1  
Amino Acid Sequences MPKALHFKGDKKVKKRRKAADPYDADEKPSKQLTTSAPAEAESDDSWVSADAPTDISGPIVIVLPTDSPNTCLACDANGKVFASELENIVEGDVATAEPHDVRQVFVANRIAGTEQLSLKGHHGRYLSCDKFGVLSATATAISPEETFVVVAVPDNPSAFSLQTARDKFLTIDESSGKAPEPRGDAEHIDFSTTFRIRMQARFKPRLKASKEEKANVKISRKELEDQIGRRLNDDEVKKLRKSRVQGNFHETALDMKVKSSHDKYASM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.89
3 0.89
4 0.89
5 0.91
6 0.91
7 0.9
8 0.86
9 0.8
10 0.78
11 0.68
12 0.61
13 0.55
14 0.47
15 0.42
16 0.4
17 0.34
18 0.27
19 0.32
20 0.32
21 0.35
22 0.36
23 0.32
24 0.28
25 0.28
26 0.28
27 0.23
28 0.21
29 0.14
30 0.13
31 0.11
32 0.1
33 0.1
34 0.09
35 0.09
36 0.07
37 0.08
38 0.06
39 0.07
40 0.08
41 0.09
42 0.08
43 0.08
44 0.07
45 0.07
46 0.07
47 0.06
48 0.05
49 0.05
50 0.05
51 0.06
52 0.08
53 0.09
54 0.09
55 0.1
56 0.13
57 0.14
58 0.13
59 0.13
60 0.12
61 0.13
62 0.15
63 0.14
64 0.15
65 0.16
66 0.16
67 0.14
68 0.14
69 0.13
70 0.13
71 0.12
72 0.1
73 0.09
74 0.09
75 0.09
76 0.09
77 0.08
78 0.06
79 0.05
80 0.04
81 0.04
82 0.03
83 0.03
84 0.04
85 0.04
86 0.04
87 0.07
88 0.07
89 0.07
90 0.08
91 0.11
92 0.11
93 0.15
94 0.17
95 0.15
96 0.14
97 0.15
98 0.14
99 0.11
100 0.12
101 0.11
102 0.09
103 0.11
104 0.11
105 0.12
106 0.14
107 0.18
108 0.17
109 0.18
110 0.19
111 0.17
112 0.22
113 0.3
114 0.29
115 0.24
116 0.24
117 0.21
118 0.21
119 0.21
120 0.17
121 0.08
122 0.07
123 0.06
124 0.06
125 0.06
126 0.06
127 0.05
128 0.04
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.04
138 0.04
139 0.05
140 0.05
141 0.05
142 0.06
143 0.06
144 0.06
145 0.07
146 0.07
147 0.07
148 0.08
149 0.11
150 0.18
151 0.18
152 0.2
153 0.19
154 0.2
155 0.2
156 0.2
157 0.21
158 0.14
159 0.15
160 0.15
161 0.16
162 0.16
163 0.16
164 0.14
165 0.12
166 0.13
167 0.14
168 0.16
169 0.16
170 0.18
171 0.2
172 0.22
173 0.22
174 0.24
175 0.21
176 0.19
177 0.18
178 0.16
179 0.2
180 0.18
181 0.17
182 0.14
183 0.19
184 0.21
185 0.28
186 0.36
187 0.38
188 0.48
189 0.57
190 0.6
191 0.64
192 0.69
193 0.71
194 0.68
195 0.69
196 0.68
197 0.68
198 0.71
199 0.69
200 0.69
201 0.65
202 0.67
203 0.64
204 0.64
205 0.6
206 0.57
207 0.56
208 0.52
209 0.5
210 0.46
211 0.48
212 0.48
213 0.44
214 0.49
215 0.5
216 0.46
217 0.44
218 0.42
219 0.37
220 0.37
221 0.37
222 0.37
223 0.39
224 0.45
225 0.48
226 0.54
227 0.59
228 0.59
229 0.63
230 0.65
231 0.66
232 0.69
233 0.72
234 0.73
235 0.68
236 0.6
237 0.54
238 0.44
239 0.36
240 0.3
241 0.27
242 0.19
243 0.17
244 0.21
245 0.24
246 0.31
247 0.33
248 0.38