Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177W8M8

Protein Details
Accession A0A177W8M8    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSKHEHNRRGDKSKKSSKEPVDSHBasic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito_nucl 12.333, cyto_nucl 11.333, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044688  SCI-1-like  
Amino Acid Sequences MSKHEHNRRGDKSKKSSKEPVDSHSPKPISEEHYFQKAAEFQVWLSEKGYRFHDLSKSEAQDQFKKFIRRWNKGKLDGIQALEVPFAARTGYKWNIKDIRQPRVKLQINLVSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.82
4 0.8
5 0.82
6 0.75
7 0.7
8 0.7
9 0.67
10 0.62
11 0.61
12 0.53
13 0.43
14 0.42
15 0.4
16 0.35
17 0.34
18 0.36
19 0.3
20 0.35
21 0.35
22 0.32
23 0.3
24 0.26
25 0.24
26 0.2
27 0.17
28 0.11
29 0.17
30 0.19
31 0.17
32 0.16
33 0.18
34 0.18
35 0.2
36 0.22
37 0.19
38 0.18
39 0.2
40 0.24
41 0.22
42 0.25
43 0.26
44 0.25
45 0.26
46 0.28
47 0.29
48 0.31
49 0.31
50 0.32
51 0.34
52 0.37
53 0.35
54 0.41
55 0.48
56 0.51
57 0.56
58 0.62
59 0.65
60 0.66
61 0.71
62 0.65
63 0.62
64 0.56
65 0.5
66 0.4
67 0.32
68 0.26
69 0.21
70 0.17
71 0.11
72 0.07
73 0.06
74 0.06
75 0.05
76 0.06
77 0.13
78 0.2
79 0.27
80 0.28
81 0.37
82 0.43
83 0.46
84 0.55
85 0.56
86 0.6
87 0.62
88 0.64
89 0.62
90 0.66
91 0.7
92 0.64
93 0.65