Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177WPT8

Protein Details
Accession A0A177WPT8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
134-159DDGRSRSHSRERYRDRPREGRERDGYBasic
NLS Segment(s)
PositionSequence
137-167RSRSHSRERYRDRPREGRERDGYRERGGRER
Subcellular Location(s) nucl 10, cysk 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
IPR003954  RRM_dom_euk  
IPR009145  U2AF_small  
IPR000571  Znf_CCCH  
Gene Ontology GO:0089701  C:U2AF complex  
GO:0046872  F:metal ion binding  
GO:0003723  F:RNA binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF00076  RRM_1  
PF00642  zf-CCCH  
PROSITE View protein in PROSITE  
PS50102  RRM  
PS50103  ZF_C3H1  
Amino Acid Sequences MTPDEIQENFDLLFEDLFMELAKYGELEDMNICDNVGDHLIGNVYARFKYEEDAGNAVESLNNRFYAGRPLYAELSPVTDFGEACCRQYELGECTRGGFCNFMHIKKPSKAMIKDMYKAQRLSIKILKPRGDEDDGRSRSHSRERYRDRPREGRERDGYRERGGRERDDRRYRDYDTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.07
5 0.07
6 0.06
7 0.06
8 0.06
9 0.06
10 0.05
11 0.05
12 0.07
13 0.07
14 0.08
15 0.08
16 0.09
17 0.11
18 0.11
19 0.1
20 0.08
21 0.08
22 0.08
23 0.08
24 0.07
25 0.06
26 0.06
27 0.07
28 0.07
29 0.07
30 0.08
31 0.08
32 0.08
33 0.09
34 0.11
35 0.11
36 0.13
37 0.16
38 0.17
39 0.18
40 0.2
41 0.19
42 0.17
43 0.17
44 0.15
45 0.13
46 0.1
47 0.1
48 0.1
49 0.1
50 0.1
51 0.11
52 0.11
53 0.18
54 0.19
55 0.18
56 0.18
57 0.19
58 0.21
59 0.2
60 0.21
61 0.13
62 0.14
63 0.12
64 0.11
65 0.1
66 0.08
67 0.08
68 0.08
69 0.15
70 0.13
71 0.13
72 0.14
73 0.13
74 0.13
75 0.14
76 0.15
77 0.12
78 0.14
79 0.15
80 0.15
81 0.16
82 0.16
83 0.16
84 0.14
85 0.12
86 0.09
87 0.17
88 0.18
89 0.18
90 0.22
91 0.25
92 0.3
93 0.32
94 0.36
95 0.32
96 0.38
97 0.39
98 0.4
99 0.46
100 0.45
101 0.44
102 0.47
103 0.48
104 0.44
105 0.43
106 0.39
107 0.36
108 0.33
109 0.37
110 0.37
111 0.37
112 0.39
113 0.46
114 0.48
115 0.44
116 0.46
117 0.46
118 0.44
119 0.4
120 0.4
121 0.44
122 0.42
123 0.41
124 0.41
125 0.37
126 0.36
127 0.44
128 0.46
129 0.45
130 0.54
131 0.62
132 0.7
133 0.79
134 0.84
135 0.84
136 0.85
137 0.84
138 0.84
139 0.81
140 0.8
141 0.79
142 0.75
143 0.74
144 0.73
145 0.69
146 0.65
147 0.64
148 0.58
149 0.57
150 0.56
151 0.57
152 0.58
153 0.63
154 0.67
155 0.72
156 0.73
157 0.72
158 0.73