Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177WYE4

Protein Details
Accession A0A177WYE4   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
106-130KLLYKKLKYSSRKVRKVRKDKYGLMHydrophilic
NLS Segment(s)
PositionSequence
113-125KYSSRKVRKVRKD
Subcellular Location(s) nucl 6golg 6, extr 4, E.R. 4, mito_nucl 4, pero 3
Family & Domain DBs
Amino Acid Sequences MKLTVVVLSSILAVCSVTIADPVNPTATTSTQSSSAALPSATTGTYPDPWMAPNAQVTNSVDFSRLPESTIDLIQEYARVKESYEQTYGMYESLKLEKIDQEQWTKLLYKKLKYSSRKVRKVRKDKYGLMYKKELKEFRELKLEIETQNGILFELQKKCMDLGSKYSELRWKFAKIQVLLVECLYGKHINYESISYYLDYVESNPEFMKLVDTLRSSVPNQQSGSVQASTSGIQDSQLYESLLSSSDDEMEFLDETHSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.06
6 0.07
7 0.09
8 0.1
9 0.11
10 0.13
11 0.13
12 0.14
13 0.15
14 0.15
15 0.16
16 0.17
17 0.17
18 0.17
19 0.18
20 0.18
21 0.16
22 0.16
23 0.14
24 0.12
25 0.11
26 0.1
27 0.1
28 0.09
29 0.08
30 0.09
31 0.11
32 0.13
33 0.14
34 0.13
35 0.13
36 0.14
37 0.16
38 0.16
39 0.15
40 0.18
41 0.18
42 0.18
43 0.2
44 0.22
45 0.22
46 0.22
47 0.21
48 0.17
49 0.16
50 0.18
51 0.18
52 0.17
53 0.14
54 0.13
55 0.16
56 0.17
57 0.17
58 0.15
59 0.12
60 0.12
61 0.11
62 0.14
63 0.12
64 0.11
65 0.13
66 0.12
67 0.12
68 0.17
69 0.21
70 0.22
71 0.23
72 0.23
73 0.21
74 0.22
75 0.22
76 0.16
77 0.13
78 0.09
79 0.09
80 0.11
81 0.12
82 0.11
83 0.12
84 0.14
85 0.17
86 0.21
87 0.23
88 0.24
89 0.23
90 0.24
91 0.25
92 0.24
93 0.24
94 0.27
95 0.29
96 0.29
97 0.35
98 0.43
99 0.5
100 0.54
101 0.61
102 0.64
103 0.71
104 0.77
105 0.79
106 0.81
107 0.83
108 0.88
109 0.86
110 0.85
111 0.81
112 0.77
113 0.75
114 0.75
115 0.68
116 0.61
117 0.6
118 0.55
119 0.52
120 0.52
121 0.47
122 0.39
123 0.45
124 0.43
125 0.38
126 0.41
127 0.37
128 0.33
129 0.34
130 0.33
131 0.24
132 0.24
133 0.21
134 0.13
135 0.14
136 0.13
137 0.09
138 0.07
139 0.09
140 0.11
141 0.13
142 0.14
143 0.14
144 0.15
145 0.15
146 0.16
147 0.17
148 0.14
149 0.18
150 0.22
151 0.25
152 0.24
153 0.26
154 0.3
155 0.29
156 0.31
157 0.28
158 0.27
159 0.28
160 0.32
161 0.37
162 0.32
163 0.34
164 0.35
165 0.34
166 0.3
167 0.26
168 0.22
169 0.15
170 0.14
171 0.13
172 0.11
173 0.09
174 0.12
175 0.13
176 0.14
177 0.15
178 0.17
179 0.16
180 0.16
181 0.17
182 0.14
183 0.13
184 0.11
185 0.11
186 0.09
187 0.09
188 0.13
189 0.12
190 0.13
191 0.13
192 0.13
193 0.13
194 0.13
195 0.14
196 0.1
197 0.12
198 0.14
199 0.16
200 0.17
201 0.18
202 0.21
203 0.21
204 0.27
205 0.31
206 0.32
207 0.32
208 0.32
209 0.32
210 0.32
211 0.34
212 0.27
213 0.22
214 0.18
215 0.18
216 0.17
217 0.16
218 0.14
219 0.1
220 0.1
221 0.11
222 0.12
223 0.13
224 0.14
225 0.13
226 0.12
227 0.13
228 0.12
229 0.13
230 0.12
231 0.11
232 0.1
233 0.12
234 0.12
235 0.11
236 0.11
237 0.12
238 0.11
239 0.1