Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177WBI3

Protein Details
Accession A0A177WBI3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTLKRRNNGRSKKGRGHVNHVRBasic
NLS Segment(s)
PositionSequence
6-14RNNGRSKKG
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTLKRRNNGRSKKGRGHVNHVRCSNCCRCVPKDKAIKRFLIRNMVEAAAVSDIASASVFPEYALPKLYIKTLYCISCAIHAHIVRVRSRVGRRDRTPPQRFHAFNKGAQNKAKPATATKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.81
3 0.8
4 0.8
5 0.78
6 0.77
7 0.72
8 0.68
9 0.6
10 0.62
11 0.59
12 0.54
13 0.51
14 0.48
15 0.49
16 0.56
17 0.6
18 0.61
19 0.65
20 0.67
21 0.71
22 0.7
23 0.71
24 0.65
25 0.65
26 0.6
27 0.59
28 0.51
29 0.44
30 0.4
31 0.33
32 0.3
33 0.22
34 0.19
35 0.09
36 0.08
37 0.06
38 0.04
39 0.04
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.05
48 0.06
49 0.06
50 0.08
51 0.08
52 0.09
53 0.1
54 0.11
55 0.12
56 0.12
57 0.14
58 0.17
59 0.17
60 0.17
61 0.17
62 0.16
63 0.17
64 0.18
65 0.17
66 0.18
67 0.18
68 0.2
69 0.21
70 0.24
71 0.22
72 0.23
73 0.24
74 0.26
75 0.31
76 0.38
77 0.45
78 0.52
79 0.54
80 0.63
81 0.71
82 0.75
83 0.78
84 0.76
85 0.73
86 0.73
87 0.72
88 0.69
89 0.69
90 0.62
91 0.59
92 0.64
93 0.63
94 0.6
95 0.63
96 0.61
97 0.57
98 0.57
99 0.55
100 0.46