Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177WHC0

Protein Details
Accession A0A177WHC0   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
94-131RHGLAEAKKTNRKQRKEKKNRAKKFRGTKKAKASAAKKBasic
NLS Segment(s)
PositionSequence
91-131RLVRHGLAEAKKTNRKQRKEKKNRAKKFRGTKKAKASAAKK
Subcellular Location(s) mito 18, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MAADAVTIRTRKFLTNRLLQRKQMVVDIIHPGSPNISKTELREKISKVYKSETENVFVFGVKTAFGGGKSTGFALIYDTLDAAKKFEPKYRLVRHGLAEAKKTNRKQRKEKKNRAKKFRGTKKAKASAAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.49
3 0.59
4 0.66
5 0.71
6 0.68
7 0.68
8 0.64
9 0.57
10 0.5
11 0.42
12 0.33
13 0.29
14 0.31
15 0.26
16 0.23
17 0.22
18 0.18
19 0.18
20 0.18
21 0.16
22 0.13
23 0.16
24 0.17
25 0.2
26 0.3
27 0.33
28 0.35
29 0.39
30 0.38
31 0.43
32 0.49
33 0.49
34 0.41
35 0.4
36 0.41
37 0.41
38 0.46
39 0.39
40 0.34
41 0.31
42 0.3
43 0.26
44 0.21
45 0.17
46 0.11
47 0.1
48 0.06
49 0.06
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.07
63 0.07
64 0.06
65 0.06
66 0.07
67 0.08
68 0.08
69 0.08
70 0.09
71 0.14
72 0.15
73 0.21
74 0.24
75 0.29
76 0.39
77 0.45
78 0.51
79 0.51
80 0.53
81 0.49
82 0.52
83 0.53
84 0.47
85 0.44
86 0.42
87 0.45
88 0.5
89 0.55
90 0.59
91 0.63
92 0.7
93 0.76
94 0.82
95 0.85
96 0.89
97 0.93
98 0.93
99 0.95
100 0.96
101 0.95
102 0.95
103 0.94
104 0.94
105 0.94
106 0.93
107 0.91
108 0.9
109 0.9
110 0.89
111 0.86