Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177WH05

Protein Details
Accession A0A177WH05    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
119-152SGESFRSRYKKMKRLKQECKEAKQKEKDLRKEFEBasic
NLS Segment(s)
PositionSequence
128-149KKMKRLKQECKEAKQKEKDLRK
158-172GWRGKLKRLKKMLTK
Subcellular Location(s) nucl 8, golg 6, E.R. 5, mito_nucl 5, extr 3
Family & Domain DBs
Amino Acid Sequences MGGSNIILVLSVSAVASALVATPNAETRSHQLSKRSPGKGWEKLVEDNPNDDDASEPGPSNDGNSVESRLADAKRQREDICDKYRKYKDDLNQDALEYGFVDDVLSNQSSTEQYGDVDSGESFRSRYKKMKRLKQECKEAKQKEKDLRKEFEEQSGTGWRGKLKRLKKMLTKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.03
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.09
11 0.11
12 0.12
13 0.13
14 0.17
15 0.25
16 0.3
17 0.32
18 0.37
19 0.42
20 0.52
21 0.59
22 0.58
23 0.52
24 0.56
25 0.62
26 0.62
27 0.6
28 0.55
29 0.5
30 0.5
31 0.52
32 0.51
33 0.43
34 0.37
35 0.34
36 0.3
37 0.26
38 0.22
39 0.18
40 0.12
41 0.13
42 0.11
43 0.1
44 0.08
45 0.09
46 0.09
47 0.09
48 0.1
49 0.09
50 0.1
51 0.1
52 0.12
53 0.12
54 0.12
55 0.11
56 0.13
57 0.13
58 0.16
59 0.2
60 0.24
61 0.27
62 0.3
63 0.3
64 0.32
65 0.38
66 0.4
67 0.45
68 0.47
69 0.45
70 0.51
71 0.55
72 0.52
73 0.5
74 0.49
75 0.46
76 0.49
77 0.53
78 0.48
79 0.44
80 0.42
81 0.38
82 0.31
83 0.25
84 0.14
85 0.1
86 0.05
87 0.04
88 0.04
89 0.03
90 0.04
91 0.06
92 0.06
93 0.05
94 0.06
95 0.07
96 0.07
97 0.08
98 0.08
99 0.07
100 0.07
101 0.08
102 0.08
103 0.07
104 0.07
105 0.06
106 0.07
107 0.07
108 0.07
109 0.07
110 0.12
111 0.16
112 0.2
113 0.3
114 0.39
115 0.47
116 0.57
117 0.67
118 0.73
119 0.8
120 0.87
121 0.87
122 0.89
123 0.89
124 0.88
125 0.89
126 0.86
127 0.85
128 0.84
129 0.83
130 0.82
131 0.83
132 0.84
133 0.81
134 0.79
135 0.73
136 0.72
137 0.65
138 0.63
139 0.56
140 0.46
141 0.42
142 0.42
143 0.39
144 0.33
145 0.33
146 0.31
147 0.31
148 0.4
149 0.45
150 0.48
151 0.56
152 0.64
153 0.71