Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177WRV7

Protein Details
Accession A0A177WRV7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
202-227ASTPAYPTKKKCRHRKTKGGETPVPTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, golg 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MKVSIFVLALAAAVTAAPFGYGNNSPSTTPAVPSTTTSIVETPVPKPQSSTSTTTTTKHGYHHNSSASKHTTAHHSKPVETPAPKATPTPTPAYPVPETPVPTVVSTPCESPVETPVPTVASTPAYPVPETPVPTVATTPVVPVPYGGGETPVPTAASTPAYPTPETPVPTVATTPAYPTAETPVPTVATTPSVPETPVPEASTPAYPTKKKCRHRKTKGGETPVPTVATTPAVPETPAPEISPPAPYGGGETPVPTVATTPVGPETPAPEIPSPAPYGGAYPTPETPVPTVATTPAYPTPETPVPTVVSTPPTTPCSETPTPETPAVPENFRPNCSVHSPNYSLLRDSHSRDTGSQLLPLLRLTPLPRLQSQLLYLPQLSPKTPVPTSQPLHLLPSPTVTPTPETTPCSETPTPETTPAVPETPVPTVASTPVPTVTPTPETTPCSETPTPETTPCSETATETTPVPTVVSTPAVSETPVPTVASTPVPTVTPTPETTPCSETSTPETTPCSETATETTPCSETPTETTPCSETPTETGSAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.04
5 0.04
6 0.04
7 0.09
8 0.12
9 0.14
10 0.17
11 0.19
12 0.19
13 0.21
14 0.27
15 0.24
16 0.23
17 0.25
18 0.24
19 0.24
20 0.26
21 0.29
22 0.25
23 0.25
24 0.25
25 0.22
26 0.21
27 0.24
28 0.25
29 0.22
30 0.28
31 0.3
32 0.28
33 0.31
34 0.33
35 0.35
36 0.37
37 0.41
38 0.37
39 0.41
40 0.43
41 0.42
42 0.43
43 0.41
44 0.39
45 0.37
46 0.42
47 0.43
48 0.47
49 0.52
50 0.55
51 0.54
52 0.54
53 0.58
54 0.53
55 0.47
56 0.43
57 0.39
58 0.41
59 0.45
60 0.5
61 0.5
62 0.48
63 0.49
64 0.51
65 0.56
66 0.54
67 0.47
68 0.45
69 0.44
70 0.45
71 0.43
72 0.4
73 0.36
74 0.34
75 0.37
76 0.38
77 0.32
78 0.34
79 0.35
80 0.39
81 0.38
82 0.33
83 0.33
84 0.31
85 0.33
86 0.29
87 0.3
88 0.25
89 0.23
90 0.23
91 0.21
92 0.21
93 0.19
94 0.19
95 0.19
96 0.18
97 0.18
98 0.18
99 0.22
100 0.21
101 0.2
102 0.2
103 0.18
104 0.18
105 0.18
106 0.17
107 0.13
108 0.12
109 0.12
110 0.14
111 0.16
112 0.17
113 0.17
114 0.16
115 0.21
116 0.22
117 0.25
118 0.23
119 0.23
120 0.23
121 0.23
122 0.23
123 0.18
124 0.17
125 0.14
126 0.14
127 0.13
128 0.12
129 0.12
130 0.11
131 0.11
132 0.09
133 0.1
134 0.08
135 0.09
136 0.08
137 0.09
138 0.1
139 0.09
140 0.09
141 0.08
142 0.09
143 0.08
144 0.1
145 0.09
146 0.12
147 0.14
148 0.17
149 0.17
150 0.17
151 0.22
152 0.23
153 0.25
154 0.23
155 0.22
156 0.21
157 0.21
158 0.21
159 0.16
160 0.15
161 0.13
162 0.14
163 0.15
164 0.14
165 0.14
166 0.14
167 0.17
168 0.17
169 0.18
170 0.17
171 0.15
172 0.15
173 0.14
174 0.15
175 0.11
176 0.11
177 0.1
178 0.11
179 0.11
180 0.11
181 0.11
182 0.11
183 0.14
184 0.14
185 0.15
186 0.16
187 0.14
188 0.15
189 0.16
190 0.17
191 0.16
192 0.19
193 0.23
194 0.25
195 0.31
196 0.41
197 0.49
198 0.58
199 0.67
200 0.73
201 0.79
202 0.86
203 0.91
204 0.89
205 0.91
206 0.9
207 0.87
208 0.81
209 0.73
210 0.66
211 0.57
212 0.48
213 0.36
214 0.28
215 0.2
216 0.16
217 0.12
218 0.09
219 0.09
220 0.08
221 0.08
222 0.08
223 0.09
224 0.1
225 0.1
226 0.1
227 0.09
228 0.11
229 0.11
230 0.12
231 0.1
232 0.09
233 0.09
234 0.08
235 0.11
236 0.1
237 0.11
238 0.09
239 0.1
240 0.09
241 0.09
242 0.09
243 0.07
244 0.07
245 0.06
246 0.07
247 0.06
248 0.07
249 0.07
250 0.07
251 0.08
252 0.07
253 0.08
254 0.09
255 0.1
256 0.11
257 0.1
258 0.12
259 0.12
260 0.13
261 0.12
262 0.1
263 0.1
264 0.08
265 0.09
266 0.08
267 0.09
268 0.09
269 0.09
270 0.1
271 0.11
272 0.11
273 0.12
274 0.12
275 0.13
276 0.13
277 0.13
278 0.13
279 0.12
280 0.14
281 0.13
282 0.14
283 0.14
284 0.14
285 0.14
286 0.14
287 0.18
288 0.19
289 0.21
290 0.19
291 0.19
292 0.18
293 0.18
294 0.19
295 0.15
296 0.15
297 0.14
298 0.14
299 0.15
300 0.16
301 0.17
302 0.18
303 0.18
304 0.23
305 0.24
306 0.25
307 0.28
308 0.29
309 0.31
310 0.3
311 0.29
312 0.22
313 0.25
314 0.25
315 0.21
316 0.2
317 0.25
318 0.26
319 0.27
320 0.28
321 0.25
322 0.27
323 0.3
324 0.32
325 0.26
326 0.31
327 0.32
328 0.33
329 0.37
330 0.35
331 0.31
332 0.27
333 0.3
334 0.27
335 0.29
336 0.31
337 0.28
338 0.28
339 0.28
340 0.3
341 0.3
342 0.27
343 0.24
344 0.2
345 0.19
346 0.18
347 0.17
348 0.14
349 0.1
350 0.11
351 0.11
352 0.16
353 0.2
354 0.23
355 0.24
356 0.27
357 0.28
358 0.28
359 0.28
360 0.26
361 0.23
362 0.22
363 0.21
364 0.18
365 0.2
366 0.2
367 0.19
368 0.18
369 0.19
370 0.23
371 0.23
372 0.25
373 0.28
374 0.35
375 0.37
376 0.37
377 0.38
378 0.34
379 0.38
380 0.37
381 0.32
382 0.24
383 0.25
384 0.22
385 0.19
386 0.19
387 0.15
388 0.17
389 0.17
390 0.21
391 0.22
392 0.25
393 0.26
394 0.3
395 0.29
396 0.35
397 0.33
398 0.31
399 0.32
400 0.34
401 0.33
402 0.31
403 0.32
404 0.25
405 0.27
406 0.27
407 0.23
408 0.18
409 0.18
410 0.19
411 0.19
412 0.19
413 0.16
414 0.15
415 0.14
416 0.16
417 0.16
418 0.14
419 0.14
420 0.13
421 0.13
422 0.14
423 0.15
424 0.17
425 0.18
426 0.19
427 0.22
428 0.25
429 0.28
430 0.3
431 0.32
432 0.3
433 0.34
434 0.33
435 0.31
436 0.32
437 0.34
438 0.34
439 0.32
440 0.35
441 0.3
442 0.32
443 0.31
444 0.3
445 0.25
446 0.25
447 0.26
448 0.26
449 0.24
450 0.22
451 0.22
452 0.19
453 0.18
454 0.17
455 0.13
456 0.11
457 0.11
458 0.13
459 0.12
460 0.12
461 0.14
462 0.14
463 0.15
464 0.15
465 0.15
466 0.15
467 0.16
468 0.15
469 0.13
470 0.15
471 0.16
472 0.16
473 0.15
474 0.14
475 0.14
476 0.14
477 0.15
478 0.15
479 0.17
480 0.18
481 0.19
482 0.22
483 0.25
484 0.28
485 0.3
486 0.31
487 0.3
488 0.33
489 0.33
490 0.31
491 0.34
492 0.36
493 0.35
494 0.34
495 0.36
496 0.31
497 0.33
498 0.31
499 0.28
500 0.24
501 0.24
502 0.25
503 0.26
504 0.25
505 0.24
506 0.26
507 0.23
508 0.23
509 0.26
510 0.24
511 0.22
512 0.25
513 0.3
514 0.31
515 0.32
516 0.34
517 0.32
518 0.32
519 0.35
520 0.31
521 0.27
522 0.27
523 0.29