Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2XJ51

Protein Details
Accession G2XJ51    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
58-79EEYKARSKKRPAPLSSRQRRALHydrophilic
NLS Segment(s)
PositionSequence
46-77PSNARKARRLAREEYKARSKKRPAPLSSRQRR
Subcellular Location(s) cyto 14, cyto_nucl 9.5, mito 8, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016848  RNase_P/MRP_Rpp29-subunit  
IPR036980  RNase_P/MRP_Rpp29_sf  
IPR023538  RNP1  
IPR023534  Rof/RNase_P-like  
IPR002730  Rpp29/RNP1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0000172  C:ribonuclease MRP complex  
GO:0030677  C:ribonuclease P complex  
GO:0004519  F:endonuclease activity  
GO:0033204  F:ribonuclease P RNA binding  
GO:0001682  P:tRNA 5'-leader removal  
KEGG vda:VDAG_10183  -  
Pfam View protein in Pfam  
PF01868  RNase_P-MRP_p29  
Amino Acid Sequences MPPDTSAEFTQSLLARAHSPDTVSRIYTEKLQYRNLHLRPTSPPPPSNARKARRLAREEYKARSKKRPAPLSSRQRRALGLHTIPRQGQKYATYVPLHRLWLGYVREVLGGEVYGGPGAAAKLSAAEFHGAEIEVVRSNCPSRVGIKGIVLKDARFTFEVVTAQNKVKLVPKEGTMFRVEVPVADPEEATGAAGTATDAPPATAAVSSNTFAFEIMGDQFLVRGADRAGRKFKSHFLKDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.2
4 0.22
5 0.18
6 0.19
7 0.2
8 0.24
9 0.25
10 0.23
11 0.23
12 0.24
13 0.24
14 0.29
15 0.33
16 0.35
17 0.37
18 0.44
19 0.45
20 0.51
21 0.6
22 0.56
23 0.57
24 0.52
25 0.51
26 0.5
27 0.54
28 0.54
29 0.5
30 0.49
31 0.45
32 0.54
33 0.56
34 0.6
35 0.62
36 0.61
37 0.63
38 0.69
39 0.73
40 0.73
41 0.73
42 0.71
43 0.7
44 0.74
45 0.7
46 0.7
47 0.72
48 0.7
49 0.7
50 0.71
51 0.71
52 0.7
53 0.76
54 0.78
55 0.74
56 0.75
57 0.8
58 0.81
59 0.82
60 0.81
61 0.75
62 0.67
63 0.63
64 0.56
65 0.5
66 0.47
67 0.42
68 0.41
69 0.39
70 0.4
71 0.39
72 0.41
73 0.37
74 0.31
75 0.27
76 0.23
77 0.23
78 0.23
79 0.26
80 0.24
81 0.23
82 0.26
83 0.27
84 0.26
85 0.22
86 0.2
87 0.16
88 0.2
89 0.2
90 0.17
91 0.15
92 0.14
93 0.14
94 0.13
95 0.13
96 0.06
97 0.05
98 0.05
99 0.04
100 0.04
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.02
107 0.02
108 0.02
109 0.03
110 0.03
111 0.04
112 0.04
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.06
122 0.07
123 0.07
124 0.08
125 0.09
126 0.1
127 0.11
128 0.11
129 0.12
130 0.15
131 0.17
132 0.17
133 0.2
134 0.24
135 0.23
136 0.26
137 0.25
138 0.21
139 0.23
140 0.22
141 0.2
142 0.16
143 0.16
144 0.13
145 0.14
146 0.15
147 0.13
148 0.15
149 0.15
150 0.16
151 0.18
152 0.17
153 0.17
154 0.22
155 0.23
156 0.25
157 0.24
158 0.26
159 0.3
160 0.31
161 0.32
162 0.28
163 0.26
164 0.22
165 0.23
166 0.19
167 0.14
168 0.15
169 0.14
170 0.13
171 0.13
172 0.12
173 0.1
174 0.11
175 0.1
176 0.09
177 0.06
178 0.05
179 0.04
180 0.04
181 0.05
182 0.05
183 0.06
184 0.06
185 0.06
186 0.06
187 0.07
188 0.07
189 0.07
190 0.06
191 0.07
192 0.09
193 0.11
194 0.12
195 0.11
196 0.12
197 0.12
198 0.11
199 0.11
200 0.08
201 0.08
202 0.08
203 0.09
204 0.08
205 0.08
206 0.08
207 0.09
208 0.1
209 0.08
210 0.08
211 0.08
212 0.15
213 0.2
214 0.27
215 0.34
216 0.37
217 0.42
218 0.44
219 0.52
220 0.57