Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177WNV0

Protein Details
Accession A0A177WNV0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
34-63GKDTSDKHKKPSKKPSKKPNKKPSKGFSCVBasic
NLS Segment(s)
PositionSequence
32-58KRGKDTSDKHKKPSKKPSKKPNKKPSK
Subcellular Location(s) extr 23, E.R. 2, golg 2
Family & Domain DBs
Amino Acid Sequences MKLVTFLIASVSVLSVAAVVLPTDEAISSLSKRGKDTSDKHKKPSKKPSKKPNKKPSKGFSCVGCGNGSEDEDVPNPYGDYKPSGFDGGQNQYPYYPTAYSDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.04
5 0.04
6 0.03
7 0.03
8 0.03
9 0.04
10 0.04
11 0.04
12 0.04
13 0.05
14 0.07
15 0.08
16 0.12
17 0.15
18 0.17
19 0.18
20 0.2
21 0.23
22 0.3
23 0.36
24 0.43
25 0.51
26 0.54
27 0.6
28 0.66
29 0.7
30 0.72
31 0.77
32 0.77
33 0.77
34 0.83
35 0.86
36 0.9
37 0.92
38 0.94
39 0.93
40 0.93
41 0.9
42 0.9
43 0.88
44 0.86
45 0.8
46 0.71
47 0.62
48 0.56
49 0.49
50 0.41
51 0.32
52 0.23
53 0.19
54 0.18
55 0.16
56 0.11
57 0.1
58 0.11
59 0.11
60 0.12
61 0.11
62 0.1
63 0.1
64 0.1
65 0.11
66 0.11
67 0.14
68 0.14
69 0.15
70 0.17
71 0.19
72 0.18
73 0.2
74 0.26
75 0.27
76 0.31
77 0.3
78 0.29
79 0.28
80 0.29
81 0.27
82 0.24
83 0.19