Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2WW81

Protein Details
Accession G2WW81    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
134-162ATTRTGPPTTCKRRRVRRNSAAAKKYRAAHydrophilic
NLS Segment(s)
PositionSequence
145-170KRRRVRRNSAAAKKYRAAKRAAALRR
Subcellular Location(s) extr 18, plas 6, mito 3
Family & Domain DBs
KEGG vda:VDAG_01867  -  
Amino Acid Sequences MASKIMSLLSIVAAVSAHGIVTSPPPRPVGDAFRAACGNTMFNMINSDPLGNIQGMEQGRDASLASADCNLNLCKAFKFEDNPAANIQSYSPGETVNMLVRIGAPHTGIANVSVGNTITNTIIGTSLIEFTNYATTRTGPPTTCKRRRVRRNSAAAKKYRAAKRAAALRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.04
5 0.04
6 0.04
7 0.05
8 0.11
9 0.15
10 0.17
11 0.19
12 0.21
13 0.22
14 0.25
15 0.29
16 0.3
17 0.31
18 0.36
19 0.34
20 0.35
21 0.35
22 0.32
23 0.3
24 0.23
25 0.19
26 0.13
27 0.15
28 0.12
29 0.12
30 0.15
31 0.13
32 0.14
33 0.13
34 0.13
35 0.09
36 0.1
37 0.11
38 0.08
39 0.08
40 0.06
41 0.1
42 0.1
43 0.11
44 0.11
45 0.1
46 0.1
47 0.1
48 0.1
49 0.06
50 0.06
51 0.05
52 0.05
53 0.07
54 0.07
55 0.07
56 0.09
57 0.09
58 0.09
59 0.1
60 0.1
61 0.09
62 0.1
63 0.12
64 0.12
65 0.15
66 0.16
67 0.25
68 0.25
69 0.26
70 0.25
71 0.24
72 0.22
73 0.19
74 0.17
75 0.11
76 0.1
77 0.1
78 0.09
79 0.08
80 0.09
81 0.09
82 0.1
83 0.08
84 0.09
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.07
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.06
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.06
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.06
112 0.05
113 0.07
114 0.06
115 0.07
116 0.07
117 0.07
118 0.14
119 0.14
120 0.15
121 0.14
122 0.16
123 0.19
124 0.23
125 0.26
126 0.21
127 0.28
128 0.38
129 0.48
130 0.56
131 0.63
132 0.69
133 0.76
134 0.86
135 0.9
136 0.9
137 0.9
138 0.92
139 0.93
140 0.93
141 0.92
142 0.88
143 0.84
144 0.78
145 0.77
146 0.74
147 0.68
148 0.63
149 0.59
150 0.6