Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2XIJ7

Protein Details
Accession G2XIJ7    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-40SSARIKKNTKTQQTKFKVRCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG vda:VDAG_09979  -  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPQEIADIKQFIEICRRKDASSARIKKNTKTQQTKFKVRCQRFLYTLVLKDTDKAEKLKQSLPPSLTIQEVGKKNKSKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.39
3 0.4
4 0.37
5 0.43
6 0.48
7 0.47
8 0.52
9 0.58
10 0.58
11 0.65
12 0.67
13 0.66
14 0.7
15 0.71
16 0.7
17 0.71
18 0.69
19 0.71
20 0.77
21 0.82
22 0.76
23 0.76
24 0.76
25 0.69
26 0.71
27 0.65
28 0.61
29 0.53
30 0.52
31 0.47
32 0.4
33 0.39
34 0.32
35 0.29
36 0.24
37 0.23
38 0.22
39 0.2
40 0.19
41 0.19
42 0.21
43 0.25
44 0.28
45 0.32
46 0.37
47 0.39
48 0.43
49 0.42
50 0.42
51 0.4
52 0.39
53 0.35
54 0.3
55 0.27
56 0.29
57 0.34
58 0.36
59 0.42
60 0.47