Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177WYC6

Protein Details
Accession A0A177WYC6   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
302-371NPNPRKTTNPGPKRTGRPKPKRTGRPKPKRTGRPKPKRTGRPKPKRTRKPKRTNRPRPGRPEPGQCDPNNBasic
NLS Segment(s)
PositionSequence
305-362PRKTTNPGPKRTGRPKPKRTGRPKPKRTGRPKPKRTGRPKPKRTRKPKRTNRPRPGRP
Subcellular Location(s) nucl 17, cyto 6, pero 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001842  Peptidase_M36  
IPR027268  Peptidase_M4/M1_CTD_sf  
Gene Ontology GO:0005615  C:extracellular space  
GO:0004222  F:metalloendopeptidase activity  
GO:0008270  F:zinc ion binding  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF02128  Peptidase_M36  
CDD cd09596  M36  
Amino Acid Sequences MHDITYQYGFTEAAGNFQNDNFGKGGRDGDAVILTVQSQEKFNNANFFTPSDGQNGEMNMFIFTKTNPRRDGGLDNTIPLHEYGHGLSSRLTGGSATSQCLRTLESGGMGEGWSDIVAMIVTAKQANTPTTPIVLGDYVTNRPEGIRSHPYSTDTNVNPLTYADLQTRDEVHDIGEVWATALWEVYWNLVTKSGFSANLHDAKNAAGNIIALQNVIGGMMIQPCNPTFLDARDAIIASDAARYNGANKCEIWRGFSKRGMGPNARNHQNDFSVPAECKDGAVPSSPAPVPAPAPIPSKTTANPNPRKTTNPGPKRTGRPKPKRTGRPKPKRTGRPKPKRTGRPKPKRTRKPKRTNRPRPGRPEPGQCDPNNICCLFIGINC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.2
4 0.2
5 0.27
6 0.21
7 0.23
8 0.21
9 0.19
10 0.19
11 0.2
12 0.22
13 0.17
14 0.18
15 0.16
16 0.16
17 0.16
18 0.14
19 0.13
20 0.11
21 0.09
22 0.11
23 0.12
24 0.12
25 0.13
26 0.13
27 0.17
28 0.2
29 0.23
30 0.29
31 0.28
32 0.3
33 0.3
34 0.3
35 0.32
36 0.3
37 0.29
38 0.24
39 0.23
40 0.22
41 0.22
42 0.22
43 0.18
44 0.17
45 0.15
46 0.13
47 0.13
48 0.11
49 0.1
50 0.1
51 0.2
52 0.26
53 0.33
54 0.34
55 0.36
56 0.39
57 0.42
58 0.48
59 0.43
60 0.46
61 0.39
62 0.37
63 0.36
64 0.33
65 0.3
66 0.23
67 0.18
68 0.09
69 0.1
70 0.09
71 0.13
72 0.13
73 0.13
74 0.13
75 0.13
76 0.13
77 0.12
78 0.11
79 0.07
80 0.08
81 0.13
82 0.13
83 0.14
84 0.16
85 0.17
86 0.18
87 0.18
88 0.19
89 0.15
90 0.16
91 0.14
92 0.12
93 0.12
94 0.11
95 0.11
96 0.09
97 0.08
98 0.06
99 0.05
100 0.04
101 0.04
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.04
109 0.05
110 0.05
111 0.06
112 0.08
113 0.1
114 0.11
115 0.12
116 0.12
117 0.13
118 0.13
119 0.12
120 0.12
121 0.1
122 0.09
123 0.09
124 0.1
125 0.11
126 0.11
127 0.11
128 0.1
129 0.1
130 0.12
131 0.12
132 0.16
133 0.23
134 0.25
135 0.28
136 0.29
137 0.32
138 0.32
139 0.33
140 0.33
141 0.26
142 0.27
143 0.24
144 0.23
145 0.2
146 0.19
147 0.19
148 0.13
149 0.14
150 0.11
151 0.12
152 0.13
153 0.14
154 0.15
155 0.13
156 0.13
157 0.11
158 0.1
159 0.09
160 0.09
161 0.08
162 0.07
163 0.06
164 0.06
165 0.06
166 0.05
167 0.05
168 0.04
169 0.03
170 0.04
171 0.04
172 0.05
173 0.05
174 0.06
175 0.06
176 0.08
177 0.08
178 0.08
179 0.09
180 0.1
181 0.1
182 0.1
183 0.13
184 0.14
185 0.2
186 0.2
187 0.18
188 0.17
189 0.17
190 0.18
191 0.15
192 0.12
193 0.06
194 0.06
195 0.07
196 0.07
197 0.06
198 0.04
199 0.04
200 0.04
201 0.04
202 0.04
203 0.03
204 0.02
205 0.03
206 0.05
207 0.05
208 0.06
209 0.07
210 0.07
211 0.09
212 0.09
213 0.1
214 0.09
215 0.11
216 0.14
217 0.14
218 0.14
219 0.13
220 0.13
221 0.11
222 0.11
223 0.09
224 0.06
225 0.08
226 0.08
227 0.07
228 0.08
229 0.08
230 0.12
231 0.15
232 0.17
233 0.15
234 0.16
235 0.18
236 0.24
237 0.25
238 0.25
239 0.28
240 0.34
241 0.38
242 0.41
243 0.43
244 0.4
245 0.46
246 0.48
247 0.48
248 0.48
249 0.53
250 0.57
251 0.6
252 0.57
253 0.54
254 0.51
255 0.47
256 0.4
257 0.34
258 0.27
259 0.23
260 0.22
261 0.2
262 0.2
263 0.17
264 0.17
265 0.14
266 0.13
267 0.12
268 0.13
269 0.14
270 0.12
271 0.16
272 0.16
273 0.16
274 0.16
275 0.16
276 0.15
277 0.15
278 0.17
279 0.17
280 0.2
281 0.21
282 0.23
283 0.23
284 0.26
285 0.25
286 0.32
287 0.38
288 0.45
289 0.53
290 0.58
291 0.64
292 0.64
293 0.68
294 0.65
295 0.67
296 0.67
297 0.68
298 0.68
299 0.69
300 0.74
301 0.79
302 0.83
303 0.83
304 0.83
305 0.84
306 0.87
307 0.9
308 0.92
309 0.93
310 0.94
311 0.94
312 0.94
313 0.95
314 0.95
315 0.95
316 0.95
317 0.95
318 0.95
319 0.95
320 0.95
321 0.95
322 0.95
323 0.95
324 0.95
325 0.95
326 0.95
327 0.95
328 0.95
329 0.95
330 0.95
331 0.95
332 0.96
333 0.96
334 0.97
335 0.97
336 0.97
337 0.97
338 0.97
339 0.97
340 0.97
341 0.98
342 0.97
343 0.97
344 0.96
345 0.95
346 0.94
347 0.93
348 0.9
349 0.89
350 0.85
351 0.83
352 0.81
353 0.71
354 0.7
355 0.64
356 0.62
357 0.57
358 0.5
359 0.41
360 0.33
361 0.35