Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2X4J0

Protein Details
Accession G2X4J0    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
28-54CVTGWHLRQRHHRLKRAKEANRANDTEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, nucl 3, mito 2, plas 2, cyto_nucl 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG vda:VDAG_05072  -  
Amino Acid Sequences MEGYGFTLTGGAIFGIVIGAIIVLVAICVTGWHLRQRHHRLKRAKEANRANDTELAVRSSNTRRQLREVPAPASAASTPAPQAFQSPSTYGDFAPQHQVHRGPSIEQSSAHDRYFYLQDPYSPQQILGAPWVHRQSAHDRYFYLRDPYVQLSSPPRRQHQADRGERQLTHHAGTHRHHDRQESQEASQTHHSARNGQQQHQRHDATPVRRPRDAQHQQERKESKGETGKPVHASQKPRREGPLADLVRYNPPTVAPPVGGIKPQEEEQPAVVQPGKRRLNRRASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.02
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.02
12 0.02
13 0.02
14 0.02
15 0.02
16 0.05
17 0.08
18 0.1
19 0.18
20 0.22
21 0.29
22 0.41
23 0.52
24 0.61
25 0.68
26 0.75
27 0.78
28 0.84
29 0.89
30 0.89
31 0.87
32 0.86
33 0.86
34 0.86
35 0.84
36 0.76
37 0.67
38 0.6
39 0.53
40 0.46
41 0.37
42 0.3
43 0.22
44 0.2
45 0.22
46 0.24
47 0.29
48 0.35
49 0.41
50 0.41
51 0.47
52 0.55
53 0.57
54 0.61
55 0.59
56 0.52
57 0.47
58 0.45
59 0.38
60 0.32
61 0.25
62 0.17
63 0.13
64 0.12
65 0.11
66 0.11
67 0.12
68 0.1
69 0.12
70 0.13
71 0.14
72 0.15
73 0.15
74 0.17
75 0.18
76 0.19
77 0.17
78 0.2
79 0.19
80 0.18
81 0.26
82 0.24
83 0.24
84 0.26
85 0.28
86 0.24
87 0.27
88 0.27
89 0.2
90 0.22
91 0.24
92 0.22
93 0.2
94 0.22
95 0.25
96 0.27
97 0.25
98 0.22
99 0.19
100 0.2
101 0.22
102 0.2
103 0.17
104 0.14
105 0.15
106 0.2
107 0.23
108 0.23
109 0.2
110 0.19
111 0.17
112 0.17
113 0.17
114 0.14
115 0.14
116 0.13
117 0.16
118 0.17
119 0.16
120 0.15
121 0.17
122 0.21
123 0.29
124 0.31
125 0.28
126 0.27
127 0.3
128 0.32
129 0.31
130 0.28
131 0.18
132 0.17
133 0.18
134 0.2
135 0.19
136 0.16
137 0.17
138 0.21
139 0.28
140 0.33
141 0.35
142 0.36
143 0.39
144 0.42
145 0.49
146 0.5
147 0.53
148 0.56
149 0.56
150 0.58
151 0.57
152 0.54
153 0.48
154 0.46
155 0.37
156 0.29
157 0.27
158 0.25
159 0.28
160 0.3
161 0.36
162 0.36
163 0.38
164 0.38
165 0.4
166 0.43
167 0.43
168 0.49
169 0.42
170 0.37
171 0.39
172 0.37
173 0.36
174 0.34
175 0.3
176 0.25
177 0.26
178 0.26
179 0.26
180 0.31
181 0.38
182 0.38
183 0.43
184 0.49
185 0.52
186 0.58
187 0.59
188 0.56
189 0.47
190 0.51
191 0.52
192 0.49
193 0.51
194 0.54
195 0.52
196 0.52
197 0.53
198 0.5
199 0.54
200 0.58
201 0.59
202 0.61
203 0.65
204 0.67
205 0.74
206 0.73
207 0.65
208 0.6
209 0.51
210 0.48
211 0.48
212 0.49
213 0.47
214 0.49
215 0.51
216 0.49
217 0.52
218 0.52
219 0.49
220 0.54
221 0.56
222 0.61
223 0.62
224 0.62
225 0.63
226 0.59
227 0.55
228 0.51
229 0.52
230 0.44
231 0.4
232 0.38
233 0.35
234 0.38
235 0.38
236 0.32
237 0.22
238 0.21
239 0.23
240 0.25
241 0.25
242 0.18
243 0.19
244 0.22
245 0.23
246 0.25
247 0.23
248 0.22
249 0.22
250 0.24
251 0.26
252 0.25
253 0.25
254 0.25
255 0.27
256 0.25
257 0.26
258 0.29
259 0.27
260 0.31
261 0.4
262 0.47
263 0.5
264 0.59
265 0.65