Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177X0P1

Protein Details
Accession A0A177X0P1    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
76-103PDEFQKKTRERWTRKLDKEKVKKKLQANBasic
NLS Segment(s)
PositionSequence
82-99KTRERWTRKLDKEKVKKK
Subcellular Location(s) nucl 17.5, mito_nucl 9.833, cyto 6.5, cyto_mito 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001461  Aspartic_peptidase_A1  
IPR021109  Peptidase_aspartic_dom_sf  
Gene Ontology GO:0004190  F:aspartic-type endopeptidase activity  
GO:0006508  P:proteolysis  
Amino Acid Sequences MDALYNGGAIPSNEVSLQLCQYDMLHESFINIGNTEITPKCGTDGKSVAWVQSPTNNQFSINIKSILVNGKLVELPDEFQKKTRERWTRKLDKEKVKKKLQANSPMFKYNYNIKWEKLPTVSIVMFAQTPVTYDNSNSVVTIKLGPRDYMWKYDSEKFRFAIKAGPNDKAALDIPFMSQLAVTFDRTHKRIGFGPGCGCETATSEYPTISNSDRVLWPLTQLTEQPSTSGSDGAFIRKRKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.14
4 0.16
5 0.12
6 0.12
7 0.11
8 0.12
9 0.13
10 0.14
11 0.13
12 0.13
13 0.13
14 0.13
15 0.14
16 0.17
17 0.15
18 0.13
19 0.12
20 0.12
21 0.12
22 0.15
23 0.14
24 0.15
25 0.15
26 0.15
27 0.17
28 0.21
29 0.23
30 0.25
31 0.27
32 0.25
33 0.31
34 0.31
35 0.3
36 0.29
37 0.28
38 0.23
39 0.26
40 0.3
41 0.27
42 0.3
43 0.29
44 0.26
45 0.28
46 0.31
47 0.3
48 0.28
49 0.25
50 0.22
51 0.22
52 0.23
53 0.24
54 0.21
55 0.17
56 0.14
57 0.14
58 0.15
59 0.14
60 0.14
61 0.1
62 0.1
63 0.15
64 0.19
65 0.18
66 0.22
67 0.29
68 0.3
69 0.37
70 0.46
71 0.51
72 0.55
73 0.65
74 0.71
75 0.75
76 0.82
77 0.86
78 0.85
79 0.85
80 0.88
81 0.87
82 0.85
83 0.83
84 0.81
85 0.77
86 0.76
87 0.73
88 0.73
89 0.71
90 0.67
91 0.61
92 0.59
93 0.53
94 0.45
95 0.39
96 0.36
97 0.34
98 0.34
99 0.33
100 0.29
101 0.33
102 0.34
103 0.34
104 0.27
105 0.23
106 0.18
107 0.19
108 0.18
109 0.14
110 0.12
111 0.1
112 0.09
113 0.08
114 0.08
115 0.05
116 0.05
117 0.06
118 0.07
119 0.07
120 0.07
121 0.09
122 0.11
123 0.11
124 0.11
125 0.1
126 0.09
127 0.09
128 0.12
129 0.11
130 0.13
131 0.14
132 0.14
133 0.15
134 0.21
135 0.22
136 0.23
137 0.23
138 0.23
139 0.27
140 0.34
141 0.41
142 0.39
143 0.4
144 0.36
145 0.39
146 0.36
147 0.33
148 0.33
149 0.29
150 0.34
151 0.34
152 0.36
153 0.33
154 0.33
155 0.32
156 0.27
157 0.23
158 0.15
159 0.13
160 0.11
161 0.1
162 0.1
163 0.1
164 0.08
165 0.07
166 0.07
167 0.1
168 0.11
169 0.12
170 0.14
171 0.18
172 0.24
173 0.26
174 0.3
175 0.27
176 0.29
177 0.32
178 0.39
179 0.38
180 0.36
181 0.39
182 0.36
183 0.37
184 0.34
185 0.29
186 0.21
187 0.2
188 0.21
189 0.19
190 0.19
191 0.18
192 0.18
193 0.18
194 0.18
195 0.18
196 0.16
197 0.17
198 0.16
199 0.19
200 0.19
201 0.22
202 0.24
203 0.21
204 0.21
205 0.21
206 0.22
207 0.2
208 0.21
209 0.24
210 0.25
211 0.25
212 0.23
213 0.21
214 0.22
215 0.21
216 0.22
217 0.16
218 0.16
219 0.17
220 0.24
221 0.3