Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177WER2

Protein Details
Accession A0A177WER2    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-70AEGKKKKVTGRAKKRLQYNRRFVNAHydrophilic
NLS Segment(s)
PositionSequence
32-61RAGKVKGQTPKVEKAEGKKKKVTGRAKKRL
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 7, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MTDEISLDFKWCYQQVGWMCCLIGKVHGSLARAGKVKGQTPKVEKAEGKKKKVTGRAKKRLQYNRRFVNAVASFGKRKMNPSPNQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.31
4 0.31
5 0.27
6 0.26
7 0.24
8 0.25
9 0.18
10 0.14
11 0.11
12 0.11
13 0.13
14 0.15
15 0.15
16 0.18
17 0.19
18 0.2
19 0.2
20 0.2
21 0.21
22 0.22
23 0.26
24 0.28
25 0.3
26 0.32
27 0.36
28 0.43
29 0.41
30 0.42
31 0.39
32 0.41
33 0.48
34 0.51
35 0.52
36 0.49
37 0.52
38 0.55
39 0.63
40 0.66
41 0.67
42 0.7
43 0.75
44 0.8
45 0.8
46 0.83
47 0.84
48 0.84
49 0.83
50 0.82
51 0.81
52 0.76
53 0.72
54 0.62
55 0.62
56 0.53
57 0.47
58 0.4
59 0.35
60 0.33
61 0.33
62 0.4
63 0.32
64 0.35
65 0.41
66 0.48